| UniProt ID | ORML1_HUMAN | |
|---|---|---|
| UniProt AC | Q9P0S3 | |
| Protein Name | ORM1-like protein 1 | |
| Gene Name | ORMDL1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 153 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Negative regulator of sphingolipid synthesis.. | |
| Protein Sequence | MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMPQLHGVRIFGINKY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Sulfoxidation | -------MNVGVAHS -------CCCCCCCC | 9.17 | 28183972 | |
| 14 | Phosphorylation | HSEVNPNTRVMNSRG CCCCCCCCCCCCCHH | 26.37 | 29052541 | |
| 70 | Phosphorylation | FLHAVKGTPFETPDQ HHHHHCCCCCCCCCC | 21.06 | 21406692 | |
| 74 | Phosphorylation | VKGTPFETPDQGKAR HCCCCCCCCCCCCEE | 32.32 | 21406692 | |
| 79 | Ubiquitination | FETPDQGKARLLTHW CCCCCCCCEEEECCH | 25.38 | 21906983 | |
| 79 | 2-Hydroxyisobutyrylation | FETPDQGKARLLTHW CCCCCCCCEEEECCH | 25.38 | - | |
| 103 | Phosphorylation | TSSRKFFTISPIILY CCCCCEEEHHHHHHH | 24.55 | - | |
| 105 | Phosphorylation | SRKFFTISPIILYFL CCCEEEHHHHHHHHH | 13.64 | - | |
| 152 | Ubiquitination | VRIFGINKY------ EEEEEEECC------ | 50.87 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORML1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORML1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORML1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| DCNL5_HUMAN | DCUN1D5 | physical | 28514442 | |
| TTC33_HUMAN | TTC33 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
