UniProt ID | TM234_HUMAN | |
---|---|---|
UniProt AC | Q8WY98 | |
Protein Name | Transmembrane protein 234 | |
Gene Name | TMEM234 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 164 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITSSVPWTAELQLHGKGQLQTLSQKCKREASGTQSERFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
118 (in isoform 3) | Phosphorylation | - | 9.92 | - | |
118 | Phosphorylation | AVAGMVLTVIGISLC HHHHHHHHHHHHHHH | 9.92 | - | |
123 (in isoform 3) | Phosphorylation | - | 16.39 | - | |
123 | Phosphorylation | VLTVIGISLCITSSV HHHHHHHHHHHCCCC | 16.39 | - | |
127 (in isoform 3) | Phosphorylation | - | 17.60 | - | |
127 | Phosphorylation | IGISLCITSSVPWTA HHHHHHHCCCCCCCE | 17.60 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM234_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM234_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM234_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CR3L1_HUMAN | CREB3L1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...