UniProt ID | TMM54_HUMAN | |
---|---|---|
UniProt AC | Q969K7 | |
Protein Name | Transmembrane protein 54 | |
Gene Name | TMEM54 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 222 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVVNILSVTSAIVVITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTFATQGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | CLRLGGLSVGDFRKV CCCCCCCCHHHHHHH | 27.59 | 22985185 | |
20 | Phosphorylation | FRKVLMKTGLVLVVL HHHHHHHCCCEEEEC | 23.06 | - | |
41 | Phosphorylation | TAALFHGTVLRYVGT HHHHHCCHHHHHCCC | 14.06 | - | |
87 | Phosphorylation | VLSRYLPSTPLRWTV HHHHHCCCCCCCHHH | 39.81 | 24719451 | |
221 | Phosphorylation | CTSSEPLTL------ CCCCCCCCC------ | 40.93 | 28348404 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM54_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM54_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM54_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDK2_HUMAN | CDK2 | physical | 19829063 | |
RARA_HUMAN | RARA | physical | 22982681 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...