| UniProt ID | SCAM4_HUMAN | |
|---|---|---|
| UniProt AC | Q969E2 | |
| Protein Name | Secretory carrier-associated membrane protein 4 | |
| Gene Name | SCAMP4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 229 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | Probably involved in membrane protein trafficking.. | |
| Protein Sequence | MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTNFGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSEKENNFP ------CCCCCCCCC | 58.33 | 20873877 | |
| 4 | Ubiquitination | ----MSEKENNFPPL ----CCCCCCCCCCC | 59.44 | 29901268 | |
| 18 | Ubiquitination | LPKFIPVKPCFYQNF CCCCCCCCCCCCCCC | 30.62 | 33845483 | |
| 20 | S-palmitoylation | KFIPVKPCFYQNFSD CCCCCCCCCCCCCCC | 4.04 | 29575903 | |
| 141 | Ubiquitination | WLSAIGFFQYSPGAA HHHHHHCCCCCCCHH | 5.86 | 23000965 | |
| 151 | Ubiquitination | SPGAAVVMLLPAIMF CCCHHHHHHHHHHHH | 2.27 | 23000965 | |
| 151 (in isoform 2) | Ubiquitination | - | 2.27 | 21890473 | |
| 185 (in isoform 1) | Ubiquitination | - | 40.21 | 21890473 | |
| 185 | Ubiquitination | GAGGSFQKAQTEWNT CCCCCCCCCCCCCCC | 40.21 | 23000965 | |
| 188 | Phosphorylation | GSFQKAQTEWNTGTW CCCCCCCCCCCCCCC | 48.07 | 26434776 | |
| 192 | Phosphorylation | KAQTEWNTGTWRNPP CCCCCCCCCCCCCCC | 36.74 | 25850435 | |
| 194 | Phosphorylation | QTEWNTGTWRNPPSR CCCCCCCCCCCCCCH | 21.15 | 23401153 | |
| 205 | Phosphorylation | PPSREAQYNNFSGNS CCCHHHHHCCCCCCC | 21.08 | 18083107 | |
| 209 | Phosphorylation | EAQYNNFSGNSLPEY HHHHCCCCCCCCCCC | 38.91 | 19060867 | |
| 212 | Phosphorylation | YNNFSGNSLPEYPTV HCCCCCCCCCCCCCC | 49.15 | 28102081 | |
| 216 | Phosphorylation | SGNSLPEYPTVPSYP CCCCCCCCCCCCCCC | 11.41 | 28102081 | |
| 218 | Phosphorylation | NSLPEYPTVPSYPGS CCCCCCCCCCCCCCC | 44.11 | 28102081 | |
| 221 | Phosphorylation | PEYPTVPSYPGSGQW CCCCCCCCCCCCCCC | 39.36 | 28102081 | |
| 222 | Phosphorylation | EYPTVPSYPGSGQWP CCCCCCCCCCCCCCC | 12.92 | 28102081 | |
| 225 | Phosphorylation | TVPSYPGSGQWP--- CCCCCCCCCCCC--- | 24.25 | 28102081 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCAM4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCAM4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCAM4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SCAM4_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
