UniProt ID | CATW_HUMAN | |
---|---|---|
UniProt AC | P56202 | |
Protein Name | Cathepsin W | |
Gene Name | CTSW | |
Organism | Homo sapiens (Human). | |
Sequence Length | 376 | |
Subcellular Localization | ||
Protein Description | May have a specific function in the mechanism or regulation of T-cell cytolytic activity.. | |
Protein Sequence | MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Ubiquitination | GPQPLELKEAFKLFQ CCCCCCHHHHHHHHC | 37.31 | 29967540 | |
50 | N-linked_Glycosylation | KLFQIQFNRSYLSPE HHHCCCCCHHHCCHH | 18.66 | UniProtKB CARBOHYD | |
114 | Phosphorylation | RAAGGVPSMGREIRS HHCCCCCCCCCCCCC | 31.31 | 27174698 | |
136 | Acetylation | PFSCDWRKVASAISP CCCCCHHHHHHHHCC | 37.59 | 25953088 | |
142 | Phosphorylation | RKVASAISPIKDQKN HHHHHHHCCCCCCCC | 21.93 | 25003641 | |
145 | Acetylation | ASAISPIKDQKNCNC HHHHCCCCCCCCCCC | 58.45 | 25953088 | |
148 | Ubiquitination | ISPIKDQKNCNCCWA HCCCCCCCCCCCHHH | 73.86 | - | |
205 | N-linked_Glycosylation | DAFITVLNNSGLASE HCCEEEECCCCCCCC | 35.96 | UniProtKB CARBOHYD | |
220 | Ubiquitination | KDYPFQGKVRAHRCH CCCCCCCCEEEECCC | 20.12 | 20639865 | |
311 | O-linked_Glycosylation | EEGIWAETVSSQSQP CCCEEEEECCCCCCC | 20.24 | OGP | |
316 | O-linked_Glycosylation | AETVSSQSQPQPPHP EEECCCCCCCCCCCC | 45.86 | OGP | |
324 | O-linked_Glycosylation | QPQPPHPTPYWILKN CCCCCCCCCEEEEEC | 26.44 | OGP | |
340 | Ubiquitination | WGAQWGEKGYFRLHR CCCCCCCCCCEEEEC | 55.78 | - | |
356 | Ubiquitination | SNTCGITKFPLTARV CCCCCCEECCEEEEC | 42.96 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CATW_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CATW_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CATW_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CATW_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...