FLOWR_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FLOWR_HUMAN
• UniProt AC: Q9UGQ2
• Protein Name: Calcium channel flower homolog
• Gene Name: CACFD1
• Organism: Homo sapiens (Human).
• Sequence Length: 172
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
100	Ubiquitination	VDRLRSWQKAVFYCG HHHHHHHHHHHHHHH	25.69	22817900
121	Ubiquitination	VISLTLTTLLGNAIA HHHHHHHHHHHHHHH	24.09	22817900
121 (in isoform 2)	Ubiquitination	-	24.09	21906983
135	Ubiquitination	AFATGVLYGLSALGK HHHHHHHHHHHHHCC	17.39	22817900
163	Ubiquitination	RQQADEEKLAETLEG HHHHCHHHHHHHHHC	51.45	22817900
163 (in isoform 1)	Ubiquitination	-	51.45	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FLOWR_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FLOWR_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FLOWR_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TM159_HUMAN	TMEM159	physical	25416956
TM159_HUMAN	TMEM159	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.