UniProt ID | FLOWR_HUMAN | |
---|---|---|
UniProt AC | Q9UGQ2 | |
Protein Name | Calcium channel flower homolog | |
Gene Name | CACFD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 172 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
100 | Ubiquitination | VDRLRSWQKAVFYCG HHHHHHHHHHHHHHH | 25.69 | 22817900 | |
121 | Ubiquitination | VISLTLTTLLGNAIA HHHHHHHHHHHHHHH | 24.09 | 22817900 | |
121 (in isoform 2) | Ubiquitination | - | 24.09 | 21906983 | |
135 | Ubiquitination | AFATGVLYGLSALGK HHHHHHHHHHHHHCC | 17.39 | 22817900 | |
163 | Ubiquitination | RQQADEEKLAETLEG HHHHCHHHHHHHHHC | 51.45 | 22817900 | |
163 (in isoform 1) | Ubiquitination | - | 51.45 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FLOWR_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FLOWR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FLOWR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TM159_HUMAN | TMEM159 | physical | 25416956 | |
TM159_HUMAN | TMEM159 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...