UniProt ID | TM100_HUMAN | |
---|---|---|
UniProt AC | Q9NV29 | |
Protein Name | Transmembrane protein 100 | |
Gene Name | TMEM100 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 134 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. Membrane Multi-pass membrane protein . Perikaryon. Cytoplasm, perinuclear region. Endoplasmic reticulum. Colocalized with HSPA5 in the endoplasmic reticulum (ER). Enriched in ER microsome. Colocalized wit |
|
Protein Description | Plays a role during embryonic arterial endothelium differentiation and vascular morphogenesis through the ACVRL1 receptor-dependent signaling pathway upon stimulation by bone morphogenetic proteins, such as GDF2/BMP9 and BMP10. Involved in the regulation of nociception, acting as a modulator of the interaction between TRPA1 and TRPV1, two molecular sensors and mediators of pain signals in dorsal root ganglia (DRG) neurons. Mechanistically, it weakens their interaction, thereby releasing the inhibition of TRPA1 by TRPV1 and increasing the single-channel open probability of the TRPA1-TRPV1 complex.. | |
Protein Sequence | MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MTEEPIKEILGAPK -CCCHHHHHHHCCCC | 49.79 | 22505724 | |
7 | Ubiquitination | -MTEEPIKEILGAPK -CCCHHHHHHHCCCC | 49.79 | - | |
20 | Phosphorylation | PKAHMAATMEKSPKS CCHHHHHHCCCCCCC | 19.14 | 29759185 | |
23 | Ubiquitination | HMAATMEKSPKSEVV HHHHHCCCCCCCCEE | 62.32 | - | |
24 | Phosphorylation | MAATMEKSPKSEVVI HHHHCCCCCCCCEEE | 25.01 | 29759185 | |
27 | Phosphorylation | TMEKSPKSEVVITTV HCCCCCCCCEEEEEC | 38.72 | - | |
121 | Phosphorylation | KKAKRRESQTALVAN HHHHHHHHHHHHHHC | 30.90 | 23911959 | |
123 | Phosphorylation | AKRRESQTALVANQR HHHHHHHHHHHHCHH | 31.10 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM100_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM100_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM100_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TMM79_HUMAN | TMEM79 | physical | 25416956 | |
CCD57_HUMAN | CCDC57 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...