UniProt ID | GLPA_HUMAN | |
---|---|---|
UniProt AC | P02724 | |
Protein Name | Glycophorin-A | |
Gene Name | GYPA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 150 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Appears to be colocalized with SLC4A1. |
|
Protein Description | Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV).. | |
Protein Sequence | MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MYGKIIFVL ------CCHHHHHHH | 27.42 | - | |
2 (in isoform 3) | Phosphorylation | - | 27.42 | 22673903 | |
12 (in isoform 3) | Phosphorylation | - | 25.83 | 22673903 | |
14 (in isoform 3) | Phosphorylation | - | 2.37 | 22673903 | |
21 | O-linked_Glycosylation | IVSISASSTTGVAMH HHHCCCCCCCCEEEE | 29.70 | 8286855 | |
22 | O-linked_Glycosylation | VSISASSTTGVAMHT HHCCCCCCCCEEEEE | 25.69 | 8286855 | |
23 | O-linked_Glycosylation | SISASSTTGVAMHTS HCCCCCCCCEEEEEC | 31.44 | 8286855 | |
29 | O-linked_Glycosylation | TTGVAMHTSTSSSVT CCCEEEEECCCCCCC | 22.18 | 8286855 | |
30 | O-linked_Glycosylation | TGVAMHTSTSSSVTK CCEEEEECCCCCCCH | 16.18 | 8286855 | |
31 | O-linked_Glycosylation | GVAMHTSTSSSVTKS CEEEEECCCCCCCHH | 33.51 | 8286855 | |
32 | O-linked_Glycosylation | VAMHTSTSSSVTKSY EEEEECCCCCCCHHH | 22.00 | 8286855 | |
36 | O-linked_Glycosylation | TSTSSSVTKSYISSQ ECCCCCCCHHHHHCC | 19.07 | 25452425 | |
38 | O-linked_Glycosylation | TSSSVTKSYISSQTN CCCCCCHHHHHCCCC | 20.52 | 8286855 | |
41 | O-linked_Glycosylation | SVTKSYISSQTNDTH CCCHHHHHCCCCCCC | 14.25 | 8286855 | |
44 | O-linked_Glycosylation | KSYISSQTNDTHKRD HHHHHCCCCCCCCCC | 36.69 | 8286855 | |
45 | N-linked_Glycosylation | SYISSQTNDTHKRDT HHHHCCCCCCCCCCC | 44.54 | 8286855 | |
52 | O-linked_Glycosylation | NDTHKRDTYAATPRA CCCCCCCCCCCCCCC | 21.06 | 8286855 | |
56 | O-linked_Glycosylation | KRDTYAATPRAHEVS CCCCCCCCCCCEECE | 12.72 | 8286855 | |
63 | O-linked_Glycosylation | TPRAHEVSEISVRTV CCCCEECEEEEEEEE | 26.65 | 8286855 | |
66 | O-linked_Glycosylation | AHEVSEISVRTVYPP CEECEEEEEEEECCC | 11.07 | 8286855 | |
69 | O-linked_Glycosylation | VSEISVRTVYPPEEE CEEEEEEEECCCHHH | 23.41 | 8286855 | |
121 | Phosphorylation | IRRLIKKSPSDVKPL HHHHHHCCHHHCCCC | 25.32 | 23025827 | |
123 | Phosphorylation | RLIKKSPSDVKPLPS HHHHCCHHHCCCCCC | 63.23 | 28857561 | |
130 | Phosphorylation | SDVKPLPSPDTDVPL HHCCCCCCCCCCCCC | 42.99 | 28192239 | |
133 | Phosphorylation | KPLPSPDTDVPLSSV CCCCCCCCCCCCHHE | 42.13 | 30242111 | |
138 | Phosphorylation | PDTDVPLSSVEIENP CCCCCCCHHEEECCC | 26.68 | 26657352 | |
139 | Phosphorylation | DTDVPLSSVEIENPE CCCCCCHHEEECCCC | 31.30 | 28060719 | |
147 | Phosphorylation | VEIENPETSDQ---- EEECCCCCCCC---- | 38.57 | 23025827 | |
148 | Phosphorylation | EIENPETSDQ----- EECCCCCCCC----- | 32.14 | 7798177 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLPA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLPA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLPA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SGTA_HUMAN | SGTA | physical | 25416956 | |
KEAP1_HUMAN | KEAP1 | physical | 25416956 | |
ATR_HUMAN | ATR | physical | 28514442 | |
CLDN1_HUMAN | CLDND1 | physical | 28514442 | |
TM192_HUMAN | TMEM192 | physical | 28514442 | |
GOGA7_HUMAN | GOLGA7 | physical | 28514442 | |
TCAF2_HUMAN | FAM115C | physical | 28514442 | |
EF1A2_HUMAN | EEF1A2 | physical | 28514442 | |
S22AI_HUMAN | SLC22A18 | physical | 28514442 | |
STAT2_HUMAN | STAT2 | physical | 28514442 | |
DYN3_HUMAN | DNM3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Glycosylation sites identified by solid-phase Edman degradation: O-linked glycosylation motifs on human glycophorin A."; Pisano A., Redmond J.W., Williams K.L., Gooley A.A.; Glycobiology 3:429-435(1993). Cited for: GLYCOSYLATION AT SER-21; THR-22; THR-23; THR-29; SER-30; THR-31;SER-32; THR-36; SER-38; SER-41; THR-44; ASN-45; THR-52; THR-56;SER-63; SER-66 AND THR-69, AND PARTIAL PROTEIN SEQUENCE. | |
"Amino-acid sequence and oligosaccharide attachment sites of humanerythrocyte glycophorin."; Tomita M., Marchesi V.T.; Proc. Natl. Acad. Sci. U.S.A. 72:2964-2968(1975). Cited for: PROTEIN SEQUENCE OF 20-150. | |
O-linked Glycosylation | |
Reference | PubMed |
"Glycosylation sites identified by solid-phase Edman degradation: O-linked glycosylation motifs on human glycophorin A."; Pisano A., Redmond J.W., Williams K.L., Gooley A.A.; Glycobiology 3:429-435(1993). Cited for: GLYCOSYLATION AT SER-21; THR-22; THR-23; THR-29; SER-30; THR-31;SER-32; THR-36; SER-38; SER-41; THR-44; ASN-45; THR-52; THR-56;SER-63; SER-66 AND THR-69, AND PARTIAL PROTEIN SEQUENCE. | |
"Amino-acid sequence and oligosaccharide attachment sites of humanerythrocyte glycophorin."; Tomita M., Marchesi V.T.; Proc. Natl. Acad. Sci. U.S.A. 72:2964-2968(1975). Cited for: PROTEIN SEQUENCE OF 20-150. |