UniProt ID | GOGA7_HUMAN | |
---|---|---|
UniProt AC | Q7Z5G4 | |
Protein Name | Golgin subfamily A member 7 | |
Gene Name | GOLGA7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 137 | |
Subcellular Localization |
Golgi apparatus membrane Lipid-anchor . |
|
Protein Description | May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.. | |
Protein Sequence | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Ubiquitination | QQAPVSGKVFIQRDY CCCCCCCEEEEEECC | 26.85 | 29967540 | |
29 | Ubiquitination | TRCQFQTKFPAELEN CEEEEEECCCHHHHC | 38.27 | 23000965 | |
37 | Methylation | FPAELENRIDRQQFE CCHHHHCCCCHHHHH | 23.86 | - | |
54 | Phosphorylation | VRTLNNLYAEAEKLG HHHHHHHHHHHHHHC | 12.43 | 29496907 | |
69 | S-palmitoylation | GQSYLEGCLACLTAY CCHHHHHHHHHHHHH | 1.27 | 14522980 | |
72 | S-palmitoylation | YLEGCLACLTAYTIF HHHHHHHHHHHHHHH | 1.93 | 14522980 | |
76 | Phosphorylation | CLACLTAYTIFLCME HHHHHHHHHHHHHHH | 8.64 | - | |
91 | Ubiquitination | THYEKVLKKVSKYIQ HHHHHHHHHHHHHHH | 54.86 | 23000965 | |
92 | Ubiquitination | HYEKVLKKVSKYIQE HHHHHHHHHHHHHHH | 47.80 | 23000965 | |
95 | Ubiquitination | KVLKKVSKYIQEQNE HHHHHHHHHHHHHHC | 49.73 | 23000965 | |
103 | Ubiquitination | YIQEQNEKIYAPQGL HHHHHHCCCCCCCCE | 48.87 | 23000965 | |
118 | Dimethylation | LLTDPIERGLRVIEI EECCHHHHCEEEEEE | 50.60 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GOGA7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GOGA7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GOGA3_HUMAN | GOLGA3 | physical | 14522980 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Palmitoylation | |
Reference | PubMed |
"Identification and characterization of GCP16, a novel acylated Golgiprotein that interacts with GCP170."; Ohta E., Misumi Y., Sohda M., Fujiwara T., Yano A., Ikehara Y.; J. Biol. Chem. 278:51957-51967(2003). Cited for: NUCLEOTIDE SEQUENCE [MRNA], INTERACTION WITH GOLGA3, TISSUESPECIFICITY, PALMITOYLATION AT CYS-69 AND CYS-72, MUTAGENESIS OFCYS-24; CYS-69; CYS-72 AND CYS-81, SUBCELLULAR LOCATION, AND FUNCTION. |