UniProt ID | UNC50_HUMAN | |
---|---|---|
UniProt AC | Q53HI1 | |
Protein Name | Protein unc-50 homolog | |
Gene Name | UNC50 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 259 | |
Subcellular Localization |
Nucleus inner membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA (By similarity).. | |
Protein Sequence | MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MLPSTSVN -------CCCCCCHH | 12.85 | 25732826 | |
4 | Phosphorylation | ----MLPSTSVNSLV ----CCCCCCHHHHH | 29.38 | 28464451 | |
5 | Phosphorylation | ---MLPSTSVNSLVQ ---CCCCCCHHHHHC | 34.45 | 30108239 | |
6 | Phosphorylation | --MLPSTSVNSLVQG --CCCCCCHHHHHCC | 24.52 | 25159151 | |
9 | Phosphorylation | LPSTSVNSLVQGNGV CCCCCHHHHHCCCCC | 27.97 | 28464451 | |
19 | Phosphorylation | QGNGVLNSRDAARHT CCCCCCCHHHHHHHH | 27.63 | 26074081 | |
32 | Phosphorylation | HTAGAKRYKYLRRLF HHHHHHHHHHHHHHH | 11.86 | - | |
34 | Phosphorylation | AGAKRYKYLRRLFRF HHHHHHHHHHHHHHH | 9.12 | - | |
74 | Ubiquitination | FHYRKQTKDQWARDD CCCCCCCCCHHHHCC | 45.49 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UNC50_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UNC50_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UNC50_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UNC50_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...