| UniProt ID | UNC50_HUMAN | |
|---|---|---|
| UniProt AC | Q53HI1 | |
| Protein Name | Protein unc-50 homolog | |
| Gene Name | UNC50 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 259 | |
| Subcellular Localization |
Nucleus inner membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein . |
|
| Protein Description | May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA (By similarity).. | |
| Protein Sequence | MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MLPSTSVN -------CCCCCCHH | 12.85 | 25732826 | |
| 4 | Phosphorylation | ----MLPSTSVNSLV ----CCCCCCHHHHH | 29.38 | 28464451 | |
| 5 | Phosphorylation | ---MLPSTSVNSLVQ ---CCCCCCHHHHHC | 34.45 | 30108239 | |
| 6 | Phosphorylation | --MLPSTSVNSLVQG --CCCCCCHHHHHCC | 24.52 | 25159151 | |
| 9 | Phosphorylation | LPSTSVNSLVQGNGV CCCCCHHHHHCCCCC | 27.97 | 28464451 | |
| 19 | Phosphorylation | QGNGVLNSRDAARHT CCCCCCCHHHHHHHH | 27.63 | 26074081 | |
| 32 | Phosphorylation | HTAGAKRYKYLRRLF HHHHHHHHHHHHHHH | 11.86 | - | |
| 34 | Phosphorylation | AGAKRYKYLRRLFRF HHHHHHHHHHHHHHH | 9.12 | - | |
| 74 | Ubiquitination | FHYRKQTKDQWARDD CCCCCCCCCHHHHCC | 45.49 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UNC50_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UNC50_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UNC50_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UNC50_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
