SC61G_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SC61G_HUMAN
• UniProt AC: P60059
• Protein Name: Protein transport protein Sec61 subunit gamma
• Gene Name: SEC61G
• Organism: Homo sapiens (Human).
• Sequence Length: 68
• Subcellular Localization: Endoplasmic reticulum membrane; Single-pass membrane protein.
• Protein Description: Necessary for protein translocation in the endoplasmic reticulum..
• Protein Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDQVMQFV -------CCHHHHHH	7.99	22223895
16	Ubiquitination	EPSRQFVKDSIRLVK CHHHHHHHHHHHHHH	47.23	-
18	Phosphorylation	SRQFVKDSIRLVKRC HHHHHHHHHHHHHHC	12.14	23917254

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SC61G_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SC61G_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SC61G_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SC61G_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.