BIK_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BIK_HUMAN
• UniProt AC: Q13323
• Protein Name: Bcl-2-interacting killer
• Gene Name: BIK
• Organism: Homo sapiens (Human).
• Sequence Length: 160
• Subcellular Localization: Endomembrane system; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Around the nuclear envelope, and in cytoplasmic membranes.
• Protein Description: Accelerates programmed cell death. Association to the apoptosis repressors Bcl-X(L), BHRF1, Bcl-2 or its adenovirus homolog E1B 19k protein suppresses this death-promoting activity. Does not interact with BAX..
• Protein Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSEVRPLSR ------CCCCCCCCH	44.81	-
33	Phosphorylation	TMEVLGMTDSEEDLD CEEECCCCCCHHHCC	34.28	14633680
35	Phosphorylation	EVLGMTDSEEDLDPM EECCCCCCHHHCCCC	33.45	14633680
115	Ubiquitination	MDGFTTLKENIMRFW HCCHHHHHHHHHHHH	46.77	21906983
124	Phosphorylation	NIMRFWRSPNPGSWV HHHHHHCCCCCCCCC	21.45	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
33	T	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
35	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BIK_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BIK_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
B2CL1_HUMAN	BCL2L1	physical	15694340
B2CL1_HUMAN	BCL2L1	physical	12853473
BCL2_HUMAN	BCL2	physical	12853473
A4_HUMAN	APP	physical	21832049
CRKL_HUMAN	CRKL	physical	21988832
COT2_HUMAN	NR2F2	physical	21988832
SOCS3_HUMAN	SOCS3	physical	21988832
TANK_HUMAN	TANK	physical	21988832
FATE1_HUMAN	FATE1	physical	25416956
FATE1_HUMAN	FATE1	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.