UniProt ID | BIK_HUMAN | |
---|---|---|
UniProt AC | Q13323 | |
Protein Name | Bcl-2-interacting killer | |
Gene Name | BIK | |
Organism | Homo sapiens (Human). | |
Sequence Length | 160 | |
Subcellular Localization |
Endomembrane system Single-pass membrane protein. Mitochondrion membrane Single-pass membrane protein. Around the nuclear envelope, and in cytoplasmic membranes. |
|
Protein Description | Accelerates programmed cell death. Association to the apoptosis repressors Bcl-X(L), BHRF1, Bcl-2 or its adenovirus homolog E1B 19k protein suppresses this death-promoting activity. Does not interact with BAX.. | |
Protein Sequence | MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSEVRPLSR ------CCCCCCCCH | 44.81 | - | |
33 | Phosphorylation | TMEVLGMTDSEEDLD CEEECCCCCCHHHCC | 34.28 | 14633680 | |
35 | Phosphorylation | EVLGMTDSEEDLDPM EECCCCCCHHHCCCC | 33.45 | 14633680 | |
115 | Ubiquitination | MDGFTTLKENIMRFW HCCHHHHHHHHHHHH | 46.77 | 21906983 | |
124 | Phosphorylation | NIMRFWRSPNPGSWV HHHHHHCCCCCCCCC | 21.45 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BIK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BIK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
B2CL1_HUMAN | BCL2L1 | physical | 15694340 | |
B2CL1_HUMAN | BCL2L1 | physical | 12853473 | |
BCL2_HUMAN | BCL2 | physical | 12853473 | |
A4_HUMAN | APP | physical | 21832049 | |
CRKL_HUMAN | CRKL | physical | 21988832 | |
COT2_HUMAN | NR2F2 | physical | 21988832 | |
SOCS3_HUMAN | SOCS3 | physical | 21988832 | |
TANK_HUMAN | TANK | physical | 21988832 | |
FATE1_HUMAN | FATE1 | physical | 25416956 | |
FATE1_HUMAN | FATE1 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...