UniProt ID | APOA2_HUMAN | |
---|---|---|
UniProt AC | P02652 | |
Protein Name | Apolipoprotein A-II | |
Gene Name | APOA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 100 | |
Subcellular Localization | Secreted . | |
Protein Description | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.. | |
Protein Sequence | MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Pyrrolidone_carboxylic_acid | EGALVRRQAKEPCVE HHHHHHHHCCCHHHH | 46.34 | - | |
24 | Pyrrolidone_carboxylic_acid | EGALVRRQAKEPCVE HHHHHHHHCCCHHHH | 46.34 | 24116940 | |
24 | Pyrrolidone_carboxylic_acid | EGALVRRQAKEPCVE HHHHHHHHCCCHHHH | 46.34 | 24116940 | |
32 | Phosphorylation | AKEPCVESLVSQYFQ CCCHHHHHHHHHHHH | 17.42 | 19824718 | |
32 | O-linked_Glycosylation | AKEPCVESLVSQYFQ CCCHHHHHHHHHHHH | 17.42 | OGP | |
35 | Phosphorylation | PCVESLVSQYFQTVT HHHHHHHHHHHHHHH | 25.18 | 27130503 | |
35 | O-linked_Glycosylation | PCVESLVSQYFQTVT HHHHHHHHHHHHHHH | 25.18 | OGP | |
37 | Phosphorylation | VESLVSQYFQTVTDY HHHHHHHHHHHHHHH | 7.08 | 26657352 | |
37 | Nitration | VESLVSQYFQTVTDY HHHHHHHHHHHHHHH | 7.08 | - | |
42 | O-linked_Glycosylation | SQYFQTVTDYGKDLM HHHHHHHHHHHHHHH | 27.22 | 55832773 | |
42 | Phosphorylation | SQYFQTVTDYGKDLM HHHHHHHHHHHHHHH | 27.22 | - | |
44 | Nitration | YFQTVTDYGKDLMEK HHHHHHHHHHHHHHH | 19.40 | - | |
49 | Oxidation | TDYGKDLMEKVKSPE HHHHHHHHHHHCCHH | 7.21 | 12576517 | |
49 | Methionine sulfoxide | TDYGKDLMEKVKSPE HHHHHHHHHHHCCHH | 7.21 | - | |
53 | Glycation | KDLMEKVKSPELQAE HHHHHHHCCHHHHHH | 71.94 | - | |
54 | Phosphorylation | DLMEKVKSPELQAEA HHHHHHCCHHHHHHH | 26.96 | 23911959 | |
54 | O-linked_Glycosylation | DLMEKVKSPELQAEA HHHHHHCCHHHHHHH | 26.96 | OGP | |
62 | Acetylation | PELQAEAKSYFEKSK HHHHHHHHHHHHHHH | 36.87 | 27178108 | |
62 | Glycation | PELQAEAKSYFEKSK HHHHHHHHHHHHHHH | 36.87 | - | |
67 | Glycation | EAKSYFEKSKEQLTP HHHHHHHHHHHHHHH | 57.86 | - | |
67 | Acetylation | EAKSYFEKSKEQLTP HHHHHHHHHHHHHHH | 57.86 | 27178108 | |
68 | O-linked_Glycosylation | AKSYFEKSKEQLTPL HHHHHHHHHHHHHHH | 33.94 | OGP | |
68 | Phosphorylation | AKSYFEKSKEQLTPL HHHHHHHHHHHHHHH | 33.94 | 23911959 | |
69 | Glycation | KSYFEKSKEQLTPLI HHHHHHHHHHHHHHH | 61.62 | - | |
73 | O-linked_Glycosylation | EKSKEQLTPLIKKAG HHHHHHHHHHHHHHC | 18.75 | OGP | |
73 | Phosphorylation | EKSKEQLTPLIKKAG HHHHHHHHHHHHHHC | 18.75 | 24719451 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APOA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APOA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PLTP_HUMAN | PLTP | physical | 9469594 | |
APOA1_HUMAN | APOA1 | physical | 10722751 | |
LCAT_HUMAN | LCAT | physical | 3104518 | |
DGAT1_HUMAN | DGAT1 | physical | 3104518 | |
APOD_HUMAN | APOD | physical | 3104518 | |
CTSR1_HUMAN | CATSPER1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An initial characterization of the serum phosphoproteome."; Zhou W., Ross M.M., Tessitore A., Ornstein D., Vanmeter A.,Liotta L.A., Petricoin E.F. III; J. Proteome Res. 8:5523-5531(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-32; SER-35 AND SER-68,AND MASS SPECTROMETRY. | |
Pyrrolidone carboxylic acid | |
Reference | PubMed |
"Isolation and characterization of the tryptic and cyanogen bromidepeptides of apoLp-Gln-II (apoA-II), plasma high densityapolipoprotein."; Lux S.E., John K.M., Ronan R., Brewer H.B. Jr.; J. Biol. Chem. 247:7519-7527(1972). Cited for: PROTEIN SEQUENCE OF 24-100. |