UniProt ID | DGAT1_HUMAN | |
---|---|---|
UniProt AC | O75907 | |
Protein Name | Diacylglycerol O-acyltransferase 1 | |
Gene Name | DGAT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 488 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.. | |
Protein Sequence | MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | GSSRRRRTGSRPSSH CCCCCCCCCCCCCCC | 37.38 | 23401153 | |
14 | Phosphorylation | SRRRRTGSRPSSHGG CCCCCCCCCCCCCCC | 40.17 | 30278072 | |
17 | Phosphorylation | RRTGSRPSSHGGGGP CCCCCCCCCCCCCCC | 33.58 | 30278072 | |
18 | Phosphorylation | RTGSRPSSHGGGGPA CCCCCCCCCCCCCCC | 28.91 | 30278072 | |
61 | Phosphorylation | DGDAGVGSGHWELRC CCCCCCCCCCEEEEE | 25.69 | 23898821 | |
80 | Phosphorylation | DSLFSSDSGFSNYRG HHHCCCCCCCCCHHH | 43.62 | - | |
233 | Phosphorylation | ASAGKKASSAAAPHT HHCCCHHHCCCCCCC | 29.41 | 23312004 | |
234 | Phosphorylation | SAGKKASSAAAPHTV HCCCHHHCCCCCCCC | 27.13 | 23312004 | |
240 | Phosphorylation | SSAAAPHTVSYPDNL HCCCCCCCCCCCCCC | 15.30 | 23312004 | |
242 | Phosphorylation | AAAPHTVSYPDNLTY CCCCCCCCCCCCCCH | 31.91 | 23312004 | |
243 | Phosphorylation | AAPHTVSYPDNLTYR CCCCCCCCCCCCCHH | 15.40 | 23312004 | |
248 | Phosphorylation | VSYPDNLTYRDLYYF CCCCCCCCHHHHHHH | 23.82 | 23312004 | |
249 | Phosphorylation | SYPDNLTYRDLYYFL CCCCCCCHHHHHHHH | 12.80 | 23312004 | |
316 | Phosphorylation | KPFKDMDYSRIIERL CCCCCCCHHHHHHHH | 8.00 | 22817900 | |
367 | Phosphorylation | FYRDWWNSESVTYFW HHHHHCCCCCEEEEH | 19.95 | 23684312 | |
369 | Phosphorylation | RDWWNSESVTYFWQN HHHCCCCCEEEEHHC | 21.41 | 23684312 | |
371 | Phosphorylation | WWNSESVTYFWQNWN HCCCCCEEEEHHCCC | 23.45 | 23684312 | |
391 | Malonylation | WCIRHFYKPMLRRGS HHHHHHHHHHHHCCC | 24.02 | 26320211 | |
398 | Phosphorylation | KPMLRRGSSKWMART HHHHHCCCCHHHHHH | 27.25 | 24260401 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DGAT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DGAT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DGAT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DGAT1_HUMAN | DGAT1 | physical | 11672446 | |
GBRA4_HUMAN | GABRA4 | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
615863 | Diarrhea 7 (DIAR7) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...