UniProt ID | SELK_HUMAN | |
---|---|---|
UniProt AC | Q9Y6D0 | |
Protein Name | Selenoprotein K {ECO:0000303|PubMed:27645994} | |
Gene Name | SELENOK {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:30394} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 94 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . Cell membrane Single-pass membrane protein . Probably mainly localized in the ER. |
|
Protein Description | Required for Ca(2+) flux in immune cells and plays a role in T-cell proliferation and in T-cell and neutrophil migration (By similarity). Involved in endoplasmic reticulum-associated degradation (ERAD) of soluble glycosylated proteins. [PubMed: 22016385 Required for palmitoylation and cell surface expression of CD36 and involved in macrophage uptake of low-density lipoprotein and in foam cell formation (By similarity Together with ZDHHC6, required for palmitoylation of ITPR1 in immune cells, leading to regulate ITPR1 stability and function] | |
Protein Sequence | MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MVYISNGQVL -----CEEEECCEEE | 9.42 | 29978859 | |
51 | Phosphorylation | QDVKKRRSYGNSSDS HHHHHHHHCCCCCCC | 41.23 | 25954137 | |
52 | Phosphorylation | DVKKRRSYGNSSDSR HHHHHHHCCCCCCCC | 20.65 | 28102081 | |
55 | Phosphorylation | KRRSYGNSSDSRYDD HHHHCCCCCCCCCCC | 31.03 | 28387310 | |
56 | Phosphorylation | RRSYGNSSDSRYDDG HHHCCCCCCCCCCCC | 43.54 | 29214152 | |
58 | Phosphorylation | SYGNSSDSRYDDGRG HCCCCCCCCCCCCCC | 34.39 | 29214152 | |
60 | Phosphorylation | GNSSDSRYDDGRGPP CCCCCCCCCCCCCCC | 23.49 | 17053785 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SELK_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SELK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SELK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SELK_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...