SELK_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SELK_HUMAN
• UniProt AC: Q9Y6D0
• Protein Name: Selenoprotein K {ECO:0000303|PubMed:27645994}
• Gene Name: SELENOK {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:30394}
• Organism: Homo sapiens (Human).
• Sequence Length: 94
• Subcellular Localization: Endoplasmic reticulum membrane ; Single-pass membrane protein . Cell membrane ; Single-pass membrane protein . Probably mainly localized in the ER.
• Protein Description: Required for Ca(2+) flux in immune cells and plays a role in T-cell proliferation and in T-cell and neutrophil migration (By similarity). Involved in endoplasmic reticulum-associated degradation (ERAD) of soluble glycosylated proteins. [PubMed: 22016385 Required for palmitoylation and cell surface expression of CD36 and involved in macrophage uptake of low-density lipoprotein and in foam cell formation (By similarity Together with ZDHHC6, required for palmitoylation of ITPR1 in immune cells, leading to regulate ITPR1 stability and function]
• Protein Sequence: MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MVYISNGQVL -----CEEEECCEEE	9.42	29978859
51	Phosphorylation	QDVKKRRSYGNSSDS HHHHHHHHCCCCCCC	41.23	25954137
52	Phosphorylation	DVKKRRSYGNSSDSR HHHHHHHCCCCCCCC	20.65	28102081
55	Phosphorylation	KRRSYGNSSDSRYDD HHHHCCCCCCCCCCC	31.03	28387310
56	Phosphorylation	RRSYGNSSDSRYDDG HHHCCCCCCCCCCCC	43.54	29214152
58	Phosphorylation	SYGNSSDSRYDDGRG HCCCCCCCCCCCCCC	34.39	29214152
60	Phosphorylation	GNSSDSRYDDGRGPP CCCCCCCCCCCCCCC	23.49	17053785

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SELK_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SELK_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SELK_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SELK_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.