| UniProt ID | TES_HUMAN | |
|---|---|---|
| UniProt AC | Q9UGI8 | |
| Protein Name | Testin | |
| Gene Name | TES | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 421 | |
| Subcellular Localization | Cytoplasm. Cell junction, focal adhesion. Detected along actin stress fibers. | |
| Protein Description | Scaffold protein that may play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Plays a role in the regulation of cell proliferation. May act as a tumor suppressor. Inhibits tumor cell growth.. | |
| Protein Sequence | MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Sumoylation | --MDLENKVKKMGLG --CCHHHHHHHCCCC | 46.16 | - | |
| 6 | Sumoylation | --MDLENKVKKMGLG --CCHHHHHHHCCCC | 46.16 | - | |
| 9 | Ubiquitination | DLENKVKKMGLGHEQ CHHHHHHHCCCCCCC | 40.98 | - | |
| 62 (in isoform 2) | Ubiquitination | - | 68.60 | 21890473 | |
| 62 | Ubiquitination | LSNEEDRKVGKLFED CCCHHHHHHHHHCCC | 68.60 | 21890473 | |
| 65 | Ubiquitination | EEDRKVGKLFEDTKY HHHHHHHHHCCCCCC | 53.65 | - | |
| 70 | Phosphorylation | VGKLFEDTKYTTLIA HHHHCCCCCCHHHHH | 20.82 | 28857561 | |
| 71 | 2-Hydroxyisobutyrylation | GKLFEDTKYTTLIAK HHHCCCCCCHHHHHH | 53.58 | - | |
| 71 | Sumoylation | GKLFEDTKYTTLIAK HHHCCCCCCHHHHHH | 53.58 | - | |
| 71 (in isoform 1) | Ubiquitination | - | 53.58 | 21890473 | |
| 71 | Ubiquitination | GKLFEDTKYTTLIAK HHHCCCCCCHHHHHH | 53.58 | 21890473 | |
| 71 | Sumoylation | GKLFEDTKYTTLIAK HHHCCCCCCHHHHHH | 53.58 | - | |
| 72 | Phosphorylation | KLFEDTKYTTLIAKL HHCCCCCCHHHHHHH | 13.67 | 28152594 | |
| 73 | Phosphorylation | LFEDTKYTTLIAKLK HCCCCCCHHHHHHHH | 19.38 | 28857561 | |
| 74 | Phosphorylation | FEDTKYTTLIAKLKS CCCCCCHHHHHHHHH | 17.05 | 28152594 | |
| 78 | Ubiquitination | KYTTLIAKLKSDGIP CCHHHHHHHHHCCCC | 49.83 | - | |
| 79 (in isoform 2) | Ubiquitination | - | 4.79 | 21890473 | |
| 80 | Ubiquitination | TTLIAKLKSDGIPMY HHHHHHHHHCCCCCE | 45.88 | - | |
| 80 | 2-Hydroxyisobutyrylation | TTLIAKLKSDGIPMY HHHHHHHHHCCCCCE | 45.88 | - | |
| 80 | Methylation | TTLIAKLKSDGIPMY HHHHHHHHHCCCCCE | 45.88 | 115980019 | |
| 81 | Phosphorylation | TLIAKLKSDGIPMYK HHHHHHHHCCCCCEE | 52.05 | 25159151 | |
| 87 | Phosphorylation | KSDGIPMYKRNVMIL HHCCCCCEECEEEEE | 11.05 | - | |
| 88 | 2-Hydroxyisobutyrylation | SDGIPMYKRNVMILT HCCCCCEECEEEEEC | 31.11 | - | |
| 88 | Ubiquitination | SDGIPMYKRNVMILT HCCCCCEECEEEEEC | 31.11 | 21906983 | |
| 88 | Methylation | SDGIPMYKRNVMILT HCCCCCEECEEEEEC | 31.11 | 42372825 | |
| 88 (in isoform 1) | Ubiquitination | - | 31.11 | 21890473 | |
| 93 (in isoform 2) | Ubiquitination | - | 3.60 | 21890473 | |
| 93 | Ubiquitination | MYKRNVMILTNPVAA CEECEEEEECCHHHH | 3.60 | 21890473 | |
| 95 | Phosphorylation | KRNVMILTNPVAAKK ECEEEEECCHHHHCC | 26.93 | 28555341 | |
| 101 | 2-Hydroxyisobutyrylation | LTNPVAAKKNVSINT ECCHHHHCCCCEEEE | 34.83 | - | |
| 101 | Acetylation | LTNPVAAKKNVSINT ECCHHHHCCCCEEEE | 34.83 | 26051181 | |
| 101 | Malonylation | LTNPVAAKKNVSINT ECCHHHHCCCCEEEE | 34.83 | 26320211 | |
| 102 | Ubiquitination | TNPVAAKKNVSINTV CCHHHHCCCCEEEEE | 58.83 | 21890473 | |
| 102 (in isoform 1) | Ubiquitination | - | 58.83 | 21890473 | |
| 105 | Phosphorylation | VAAKKNVSINTVTYE HHHCCCCEEEEEEEE | 21.37 | 26657352 | |
| 108 | Phosphorylation | KKNVSINTVTYEWAP CCCCEEEEEEEEECC | 16.74 | 26657352 | |
| 110 | Phosphorylation | NVSINTVTYEWAPPV CCEEEEEEEEECCCH | 17.43 | 25394399 | |
| 111 | Phosphorylation | VSINTVTYEWAPPVQ CEEEEEEEEECCCHH | 12.72 | 27259358 | |
| 125 (in isoform 2) | Ubiquitination | - | 32.23 | 21890473 | |
| 126 | Phosphorylation | NQALARQYMQMLPKE CHHHHHHHHHCCCCC | 5.46 | 27642862 | |
| 134 | 2-Hydroxyisobutyrylation | MQMLPKEKQPVAGSE HHCCCCCCCCCCCCC | 67.06 | - | |
| 134 | Ubiquitination | MQMLPKEKQPVAGSE HHCCCCCCCCCCCCC | 67.06 | 21906983 | |
| 134 (in isoform 1) | Ubiquitination | - | 67.06 | 21890473 | |
| 140 | Phosphorylation | EKQPVAGSEGAQYRK CCCCCCCCCHHHHHH | 24.10 | 28857561 | |
| 145 | Phosphorylation | AGSEGAQYRKKQLAK CCCCHHHHHHHHHHH | 24.70 | - | |
| 152 | Ubiquitination | YRKKQLAKQLPAHDQ HHHHHHHHHCCCCCC | 62.04 | - | |
| 162 | Phosphorylation | PAHDQDPSKCHELSP CCCCCCHHHCCCCCH | 57.09 | 25404012 | |
| 168 | Phosphorylation | PSKCHELSPREVKEM HHHCCCCCHHHHHHH | 20.94 | 23927012 | |
| 173 | Sumoylation | ELSPREVKEMEQFVK CCCHHHHHHHHHHHH | 46.74 | - | |
| 173 | Ubiquitination | ELSPREVKEMEQFVK CCCHHHHHHHHHHHH | 46.74 | - | |
| 173 | Sumoylation | ELSPREVKEMEQFVK CCCHHHHHHHHHHHH | 46.74 | - | |
| 183 | Sumoylation | EQFVKKYKSEALGVG HHHHHHHHHHHCCCC | 51.18 | - | |
| 183 | Ubiquitination | EQFVKKYKSEALGVG HHHHHHHHHHHCCCC | 51.18 | - | |
| 183 | 2-Hydroxyisobutyrylation | EQFVKKYKSEALGVG HHHHHHHHHHHCCCC | 51.18 | - | |
| 183 | Sumoylation | EQFVKKYKSEALGVG HHHHHHHHHHHCCCC | 51.18 | - | |
| 183 | Acetylation | EQFVKKYKSEALGVG HHHHHHHHHHHCCCC | 51.18 | 27452117 | |
| 184 | Phosphorylation | QFVKKYKSEALGVGD HHHHHHHHHHCCCCC | 25.63 | 28857561 | |
| 193 | Ubiquitination | ALGVGDVKLPCEMDA HCCCCCCCCCCEECC | 51.99 | - | |
| 193 | Acetylation | ALGVGDVKLPCEMDA HCCCCCCCCCCEECC | 51.99 | 26051181 | |
| 198 | Sulfoxidation | DVKLPCEMDAQGPKQ CCCCCCEECCCCCCC | 7.06 | 30846556 | |
| 204 | Ubiquitination | EMDAQGPKQMNIPGG EECCCCCCCCCCCCC | 69.84 | - | |
| 204 | Acetylation | EMDAQGPKQMNIPGG EECCCCCCCCCCCCC | 69.84 | 12436971 | |
| 214 | Phosphorylation | NIPGGDRSTPAAVGA CCCCCCCCCHHHCCC | 43.41 | 20068231 | |
| 215 | Phosphorylation | IPGGDRSTPAAVGAM CCCCCCCCHHHCCCC | 20.17 | 21815630 | |
| 226 | Phosphorylation | VGAMEDKSAEHKRTQ CCCCCCCCCCCCCHH | 51.73 | 24719451 | |
| 232 | Phosphorylation | KSAEHKRTQYSCYCC CCCCCCCHHEEEEEE | 36.34 | - | |
| 234 | Phosphorylation | AEHKRTQYSCYCCKL CCCCCHHEEEEEEEH | 10.49 | 28152594 | |
| 235 (in isoform 2) | Ubiquitination | - | 6.70 | 21890473 | |
| 235 | Phosphorylation | EHKRTQYSCYCCKLS CCCCHHEEEEEEEHH | 6.70 | 28152594 | |
| 237 | Phosphorylation | KRTQYSCYCCKLSMK CCHHEEEEEEEHHHC | 8.57 | 20090780 | |
| 238 | S-nitrosylation | RTQYSCYCCKLSMKE CHHEEEEEEEHHHCC | 1.61 | 2212679 | |
| 244 | Ubiquitination | YCCKLSMKEGDPAIY EEEEHHHCCCCHHHH | 55.99 | 2190698 | |
| 244 (in isoform 1) | Ubiquitination | - | 55.99 | 21890473 | |
| 251 | Phosphorylation | KEGDPAIYAERAGYD CCCCHHHHHHHCCCC | 12.43 | 27273156 | |
| 257 | Phosphorylation | IYAERAGYDKLWHPA HHHHHCCCCCCCCHH | 14.66 | 22817900 | |
| 288 | Phosphorylation | FWKNEKLYCGRHYCD HHHCCCCCCCCHHCC | 12.15 | 28152594 | |
| 298 | Acetylation | RHYCDSEKPRCAGCD CHHCCCCCCCCCCCC | 41.54 | 27452117 | |
| 298 | Ubiquitination | RHYCDSEKPRCAGCD CHHCCCCCCCCCCCC | 41.54 | - | |
| 313 | Phosphorylation | ELIFSNEYTQAENQN EEEECCCCCCCHHCC | 14.38 | - | |
| 340 | Phosphorylation | SILAGEIYVMVNDKP CCCCCEEEEEECCCC | 4.34 | - | |
| 353 | Phosphorylation | KPVCKPCYVKNHAVV CCCCCCCEECCCEEE | 24.00 | - | |
| 402 | Ubiquitination | SKCLIGQKFMPVEGM HHHHCCCCCCCCCCE | 38.12 | - | |
| 413 | Phosphorylation | VEGMVFCSVECKKRM CCCEEEEEEEEHHCC | 14.97 | 28857561 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TES_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TES_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TES_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-237; TYR-251 ANDTYR-288, AND MASS SPECTROMETRY. | |
