UniProt ID | CYC_HUMAN | |
---|---|---|
UniProt AC | P99999 | |
Protein Name | Cytochrome c | |
Gene Name | CYCS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 105 | |
Subcellular Localization | Mitochondrion intermembrane space. Loosely associated with the inner membrane. | |
Protein Description | Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.. | |
Protein Sequence | MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MGDVEKGKK ------CCCHHCCCE | 47.90 | 13933734 | |
9 | Acetylation | GDVEKGKKIFIMKCS CCHHCCCEEEEEECC | 52.06 | 25825284 | |
9 | Ubiquitination | GDVEKGKKIFIMKCS CCHHCCCEEEEEECC | 52.06 | - | |
14 | Succinylation | GKKIFIMKCSQCHTV CCEEEEEECCCCCEE | 26.39 | 27452117 | |
14 | Malonylation | GKKIFIMKCSQCHTV CCEEEEEECCCCCEE | 26.39 | 26320211 | |
15 | S-palmitoylation | KKIFIMKCSQCHTVE CEEEEEECCCCCEEE | 1.56 | 21044946 | |
18 | S-palmitoylation | FIMKCSQCHTVEKGG EEEECCCCCEEECCC | 1.34 | 21044946 | |
28 | Succinylation | VEKGGKHKTGPNLHG EECCCCCCCCCCCCC | 59.67 | 23954790 | |
28 | Malonylation | VEKGGKHKTGPNLHG EECCCCCCCCCCCCC | 59.67 | 26320211 | |
28 | Ubiquitination | VEKGGKHKTGPNLHG EECCCCCCCCCCCCC | 59.67 | - | |
28 | Sumoylation | VEKGGKHKTGPNLHG EECCCCCCCCCCCCC | 59.67 | - | |
29 | Phosphorylation | EKGGKHKTGPNLHGL ECCCCCCCCCCCCCC | 58.55 | 28348404 | |
40 | Ubiquitination | LHGLFGRKTGQAPGY CCCCCCCCCCCCCCC | 58.34 | - | |
40 | Succinylation | LHGLFGRKTGQAPGY CCCCCCCCCCCCCCC | 58.34 | 27452117 | |
40 | Acetylation | LHGLFGRKTGQAPGY CCCCCCCCCCCCCCC | 58.34 | 26051181 | |
40 | 2-Hydroxyisobutyrylation | LHGLFGRKTGQAPGY CCCCCCCCCCCCCCC | 58.34 | - | |
41 | Phosphorylation | HGLFGRKTGQAPGYS CCCCCCCCCCCCCCE | 32.92 | 20068231 | |
47 | Nitration | KTGQAPGYSYTAANK CCCCCCCCEEECCCC | 9.46 | - | |
47 | Phosphorylation | KTGQAPGYSYTAANK CCCCCCCCEEECCCC | 9.46 | 28152594 | |
48 | Phosphorylation | TGQAPGYSYTAANKN CCCCCCCEEECCCCC | 23.17 | 25159151 | |
49 | Nitration | GQAPGYSYTAANKNK CCCCCCEEECCCCCC | 7.60 | - | |
49 | Phosphorylation | GQAPGYSYTAANKNK CCCCCCEEECCCCCC | 7.60 | 21712546 | |
50 | Phosphorylation | QAPGYSYTAANKNKG CCCCCEEECCCCCCC | 17.22 | 28152594 | |
54 | Succinylation | YSYTAANKNKGIIWG CEEECCCCCCCEEEC | 56.14 | 27452117 | |
54 | Acetylation | YSYTAANKNKGIIWG CEEECCCCCCCEEEC | 56.14 | 26051181 | |
54 | Ubiquitination | YSYTAANKNKGIIWG CEEECCCCCCCEEEC | 56.14 | - | |
54 | 2-Hydroxyisobutyrylation | YSYTAANKNKGIIWG CEEECCCCCCCEEEC | 56.14 | - | |
56 | Succinylation | YTAANKNKGIIWGED EECCCCCCCEEECCH | 53.77 | - | |
56 | Ubiquitination | YTAANKNKGIIWGED EECCCCCCCEEECCH | 53.77 | - | |
56 | Succinylation | YTAANKNKGIIWGED EECCCCCCCEEECCH | 53.77 | - | |
68 | Phosphorylation | GEDTLMEYLENPKKY CCHHHHHHHHCHHHC | 12.83 | - | |
68 | Nitration | GEDTLMEYLENPKKY CCHHHHHHHHCHHHC | 12.83 | - | |
73 | Ubiquitination | MEYLENPKKYIPGTK HHHHHCHHHCCCCCE | 70.55 | - | |
73 | Acetylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCE | 70.55 | 23236377 | |
73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCE | 70.55 | - | |
73 | Succinylation | MEYLENPKKYIPGTK HHHHHCHHHCCCCCE | 70.55 | 23954790 | |
74 | Malonylation | EYLENPKKYIPGTKM HHHHCHHHCCCCCEE | 50.06 | 26320211 | |
74 | Acetylation | EYLENPKKYIPGTKM HHHHCHHHCCCCCEE | 50.06 | 2374843 | |
74 | Ubiquitination | EYLENPKKYIPGTKM HHHHCHHHCCCCCEE | 50.06 | - | |
75 | Nitration | YLENPKKYIPGTKMI HHHCHHHCCCCCEEE | 20.62 | - | |
75 | Phosphorylation | YLENPKKYIPGTKMI HHHCHHHCCCCCEEE | 20.62 | - | |
79 | Phosphorylation | PKKYIPGTKMIFVGI HHHCCCCCEEEEEEE | 16.46 | - | |
80 | Ubiquitination | KKYIPGTKMIFVGIK HHCCCCCEEEEEEEC | 35.59 | 21906983 | |
87 | Malonylation | KMIFVGIKKKEERAD EEEEEEECCHHHHHH | 52.44 | 26320211 | |
87 | 2-Hydroxyisobutyrylation | KMIFVGIKKKEERAD EEEEEEECCHHHHHH | 52.44 | - | |
87 | Acetylation | KMIFVGIKKKEERAD EEEEEEECCHHHHHH | 52.44 | 25953088 | |
87 | Ubiquitination | KMIFVGIKKKEERAD EEEEEEECCHHHHHH | 52.44 | 21890473 | |
88 | Acetylation | MIFVGIKKKEERADL EEEEEECCHHHHHHH | 64.59 | 20167786 | |
89 | Acetylation | IFVGIKKKEERADLI EEEEECCHHHHHHHH | 60.86 | 20167786 | |
98 | Nitration | ERADLIAYLKKATNE HHHHHHHHHHHHHCC | 16.44 | - | |
98 | Phosphorylation | ERADLIAYLKKATNE HHHHHHHHHHHHHCC | 16.44 | 28152594 | |
100 | Malonylation | ADLIAYLKKATNE-- HHHHHHHHHHHCC-- | 27.90 | 26320211 | |
100 | Ubiquitination | ADLIAYLKKATNE-- HHHHHHHHHHHCC-- | 27.90 | 21890473 | |
100 | Acetylation | ADLIAYLKKATNE-- HHHHHHHHHHHCC-- | 27.90 | 23236377 | |
100 | Methylation | ADLIAYLKKATNE-- HHHHHHHHHHHCC-- | 27.90 | 19608861 | |
101 | Methylation | DLIAYLKKATNE--- HHHHHHHHHHCC--- | 58.82 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
B2CL1_HUMAN | BCL2L1 | physical | 9192670 | |
CY1_HUMAN | CYC1 | physical | 6262312 | |
APAF_HUMAN | APAF1 | physical | 9267021 | |
HSP7C_HUMAN | HSPA8 | physical | 8663341 | |
CYB5_HUMAN | CYB5A | physical | 199233 | |
NDOR1_HUMAN | NDOR1 | physical | 10625700 | |
PRDX2_HUMAN | PRDX2 | physical | 22939629 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
THIL_HUMAN | ACAT1 | physical | 26344197 | |
GLRX2_HUMAN | GLRX2 | physical | 26344197 | |
IMPA1_HUMAN | IMPA1 | physical | 26344197 | |
IMPA2_HUMAN | IMPA2 | physical | 26344197 | |
NLE1_HUMAN | NLE1 | physical | 26344197 | |
TRAF6_HUMAN | TRAF6 | physical | 25241761 | |
CASP9_HUMAN | CASP9 | physical | 25241761 | |
B2CL1_HUMAN | BCL2L1 | physical | 25241761 |
loading...