UniProt ID | LIMD2_HUMAN | |
---|---|---|
UniProt AC | Q9BT23 | |
Protein Name | LIM domain-containing protein 2 {ECO:0000305} | |
Gene Name | LIMD2 {ECO:0000312|HGNC:HGNC:28142} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 127 | |
Subcellular Localization | Cytoplasm . Nucleus . Mainly found in cytoplasm, concentrated in membrane ruffles and in streaks reminiscent of focal adhesion plaques (PubMed:24590809). Also found in nucleus (PubMed:24590809). | |
Protein Description | Acts as an activator of the protein-kinase ILK, thereby regulating cell motility. [PubMed: 24590809] | |
Protein Sequence | MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MFQAAGAA -------CCCCCCCC | 5.18 | 19413330 | |
11 | Phosphorylation | AAGAAQATPSHDAKG CCCCCCCCCCCCCCC | 17.16 | 26074081 | |
13 | Phosphorylation | GAAQATPSHDAKGGG CCCCCCCCCCCCCCC | 29.64 | 26074081 | |
17 | Acetylation | ATPSHDAKGGGSSTV CCCCCCCCCCCCCCC | 65.23 | 25953088 | |
21 | Phosphorylation | HDAKGGGSSTVQRSK CCCCCCCCCCCCCCC | 26.55 | 26074081 | |
22 | Phosphorylation | DAKGGGSSTVQRSKS CCCCCCCCCCCCCCC | 35.55 | 26074081 | |
23 | Phosphorylation | AKGGGSSTVQRSKSF CCCCCCCCCCCCCCC | 23.50 | 26074081 | |
27 | Phosphorylation | GSSTVQRSKSFSLRA CCCCCCCCCCCCCHH | 18.63 | 30266825 | |
29 | Phosphorylation | STVQRSKSFSLRAQV CCCCCCCCCCCHHHH | 22.70 | 23401153 | |
31 | Phosphorylation | VQRSKSFSLRAQVKE CCCCCCCCCHHHHHH | 24.84 | 30266825 | |
45 | Ubiquitination | ETCAACQKTVYPMER HHHHHHHCCCCCHHH | 39.58 | - | |
46 | Phosphorylation | TCAACQKTVYPMERL HHHHHHCCCCCHHHH | 10.21 | 28102081 | |
48 | Phosphorylation | AACQKTVYPMERLVA HHHHCCCCCHHHHHC | 11.33 | 28102081 | |
63 | Phosphorylation | DKLIFHNSCFCCKHC CEEEECCCCEECCCC | 10.45 | 27080861 | |
78 | Phosphorylation | HTKLSLGSYAALHGE CCEEEHHHHHHHHCE | 19.52 | 27251275 | |
87 | Phosphorylation | AALHGEFYCKPHFQQ HHHHCEEEECHHHHH | 8.68 | - | |
98 | Phosphorylation | HFQQLFKSKGNYDEG HHHHHHHCCCCCCCC | 38.16 | - | |
102 | Phosphorylation | LFKSKGNYDEGFGRK HHHCCCCCCCCCCHH | 24.84 | 28796482 | |
118 | Acetylation | HKELWAHKEVDPGTK HHHHHCCCCCCCCCC | 52.25 | 23749302 | |
126 | Phosphorylation | EVDPGTKTA------ CCCCCCCCC------ | 37.12 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LIMD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LIMD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LIMD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LIMD2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |