UniProt ID | CLCB_HUMAN | |
---|---|---|
UniProt AC | P09497 | |
Protein Name | Clathrin light chain B | |
Gene Name | CLTB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 229 | |
Subcellular Localization |
Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side. Membrane, coated pit Peripheral membrane protein Cytoplasmic side. Cytoplasmic face of coated pits and vesicles. |
|
Protein Description | Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.. | |
Protein Sequence | MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | DFGFFSSSESGAPEA CCCCCCCCCCCCCHH | 34.28 | 3128543 | |
13 | Phosphorylation | GFFSSSESGAPEAAE CCCCCCCCCCCHHHH | 42.05 | 3128543 | |
87 | Phosphorylation | ANGPADGYAAIAQAD CCCCCCHHHHHHHHH | 8.07 | 22817900 | |
97 | Phosphorylation | IAQADRLTQEPESIR HHHHHHHHCCHHHHH | 31.60 | 20068231 | |
102 | Phosphorylation | RLTQEPESIRKWREE HHHCCHHHHHHHHHH | 38.11 | 20068231 | |
122 | Ubiquitination | QELDAASKVTEQEWR HHHHHHHHHCHHHHH | 48.74 | - | |
133 | Malonylation | QEWREKAKKDLEEWN HHHHHHHHHHHHHHH | 58.87 | 26320211 | |
134 | Ubiquitination | EWREKAKKDLEEWNQ HHHHHHHHHHHHHHH | 72.85 | - | |
157 (in isoform 2) | Phosphorylation | - | 14.71 | 28348404 | |
175 | Phosphorylation | DIIGYVASEEAFVKE CHHEEECCHHHHHHC | 26.40 | 21815630 | |
181 | Acetylation | ASEEAFVKESKEETP CCHHHHHHCCCCCCC | 50.22 | 26051181 | |
184 | Ubiquitination | EAFVKESKEETPGTE HHHHHCCCCCCCCCC | 61.74 | - | |
187 | Phosphorylation | VKESKEETPGTEWEK HHCCCCCCCCCCHHH | 28.27 | 21815630 | |
190 | Phosphorylation | SKEETPGTEWEKVAQ CCCCCCCCCHHHHHH | 38.84 | - | |
194 | Methylation | TPGTEWEKVAQLCDF CCCCCHHHHHHHCCC | 43.90 | - | |
194 | Ubiquitination | TPGTEWEKVAQLCDF CCCCCHHHHHHHCCC | 43.90 | - | |
199 | Glutathionylation | WEKVAQLCDFNPKSS HHHHHHHCCCCCCCC | 3.59 | 22555962 | |
204 | Acetylation | QLCDFNPKSSKQCKD HHCCCCCCCCHHHCC | 69.35 | 25953088 | |
204 | Methylation | QLCDFNPKSSKQCKD HHCCCCCCCCHHHCC | 69.35 | - | |
204 | Ubiquitination | QLCDFNPKSSKQCKD HHCCCCCCCCHHHCC | 69.35 | - | |
204 | Malonylation | QLCDFNPKSSKQCKD HHCCCCCCCCHHHCC | 69.35 | 26320211 | |
205 | Phosphorylation | LCDFNPKSSKQCKDV HCCCCCCCCHHHCCH | 43.98 | 22704991 | |
207 | Ubiquitination | DFNPKSSKQCKDVSR CCCCCCCHHHCCHHH | 67.80 | - | |
207 | Methylation | DFNPKSSKQCKDVSR CCCCCCCHHHCCHHH | 67.80 | - | |
213 | Phosphorylation | SKQCKDVSRLRSVLM CHHHCCHHHHHHHHH | 35.41 | 23898821 | |
217 | Phosphorylation | KDVSRLRSVLMSLKQ CCHHHHHHHHHHHHC | 24.97 | 29970186 | |
221 | Phosphorylation | RLRSVLMSLKQTPLS HHHHHHHHHHCCCCC | 28.40 | 29970186 | |
223 | Ubiquitination | RSVLMSLKQTPLSR- HHHHHHHHCCCCCC- | 44.83 | - | |
223 | Acetylation | RSVLMSLKQTPLSR- HHHHHHHHCCCCCC- | 44.83 | 25953088 | |
223 | Malonylation | RSVLMSLKQTPLSR- HHHHHHHHCCCCCC- | 44.83 | 26320211 | |
225 | Phosphorylation | VLMSLKQTPLSR--- HHHHHHCCCCCC--- | 25.30 | 26270265 | |
228 | Phosphorylation | SLKQTPLSR------ HHHCCCCCC------ | 36.83 | 26270265 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
205 | S | Phosphorylation | Kinase | GRK2 | P25098 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLCB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLCB_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...