UniProt ID | TPC_HUMAN | |
---|---|---|
UniProt AC | Q9HC21 | |
Protein Name | Mitochondrial thiamine pyrophosphate carrier | |
Gene Name | SLC25A19 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 320 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.. | |
Protein Sequence | MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MVGYDPKPDGR ----CCCCCCCCCCC | 20.05 | 20860994 | |
23 | Phosphorylation | FQVAVAGSVSGLVTR EEEEEECCHHHHHHH | 11.90 | 23403867 | |
25 | Phosphorylation | VAVAGSVSGLVTRAL EEEECCHHHHHHHHH | 28.27 | 23403867 | |
51 | Phosphorylation | QLQHERLSRSDPSAK HHHHHHHCCCCCCHH | 35.64 | 19798730 | |
53 | Phosphorylation | QHERLSRSDPSAKYH HHHHHCCCCCCHHHH | 50.96 | - | |
56 | Phosphorylation | RLSRSDPSAKYHGIL HHCCCCCCHHHHHHH | 42.24 | - | |
153 | Ubiquitination | FAAQGEPKVYNTLRH HHHCCCCCHHHHHHH | 53.72 | 21890473 | |
155 | Phosphorylation | AQGEPKVYNTLRHAV HCCCCCHHHHHHHHH | 14.46 | - | |
181 | Phosphorylation | FYKGLAPTLIAIFPY HHCCCHHHHHHHCCC | 25.78 | - | |
188 | Phosphorylation | TLIAIFPYAGLQFSC HHHHHCCCCCCCHHH | 11.53 | - | |
218 | Ubiquitination | GKKNENLQNLLCGSG CCCCCCHHHHHCCCC | 50.54 | 21890473 | |
218 | Ubiquitination | GKKNENLQNLLCGSG CCCCCCHHHHHCCCC | 50.54 | - | |
234 | Phosphorylation | GVISKTLTYPLDLFK CHHHCCCCCCHHHHH | 28.46 | - | |
241 | Acetylation | TYPLDLFKKRLQVGG CCCHHHHHHHHHHCC | 44.26 | 25038526 | |
263 | Acetylation | FGQVRRYKGLMDCAK HHHHHHHHCHHHHHH | 43.70 | 91041 | |
275 | Ubiquitination | CAKQVLQKEGALGFF HHHHHHHHCCCCHHH | 54.69 | 21890473 | |
275 | Succinylation | CAKQVLQKEGALGFF HHHHHHHHCCCCHHH | 54.69 | 27452117 | |
286 | Phosphorylation | LGFFKGLSPSLLKAA CHHHCCCCHHHHHHH | 22.55 | - | |
288 | Phosphorylation | FFKGLSPSLLKAALS HHCCCCHHHHHHHHH | 42.85 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TPC_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00990 | Microcephaly, Amish type | |||||
OMIM Disease | ||||||
607196 | Microcephaly, Amish type (MCPHA) | |||||
613710 | Thiamine metabolism dysfunction syndrome 4, bilateral striatal degeneration and progressive polyneuropathy type (THMD4) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...