UniProt ID | SH3L3_HUMAN | |
---|---|---|
UniProt AC | Q9H299 | |
Protein Name | SH3 domain-binding glutamic acid-rich-like protein 3 | |
Gene Name | SH3BGRL3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 93 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Could act as a modulator of glutaredoxin biological activity.. | |
Protein Sequence | MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGLRVYST ------CCCCEEEEE | 46.68 | 19413330 | |
2 | Phosphorylation | ------MSGLRVYST ------CCCCEEEEE | 46.68 | 27486199 | |
5 | Methylation | ---MSGLRVYSTSVT ---CCCCEEEEEECC | 28.93 | 115916841 | |
7 | Phosphorylation | -MSGLRVYSTSVTGS -CCCCEEEEEECCCC | 10.37 | 28152594 | |
8 | Phosphorylation | MSGLRVYSTSVTGSR CCCCEEEEEECCCCH | 16.02 | 28152594 | |
9 | Phosphorylation | SGLRVYSTSVTGSRE CCCEEEEEECCCCHH | 14.99 | 28152594 | |
10 | Phosphorylation | GLRVYSTSVTGSREI CCEEEEEECCCCHHH | 16.25 | 28152594 | |
12 | Phosphorylation | RVYSTSVTGSREIKS EEEEEECCCCHHHHC | 29.25 | 21406692 | |
14 | Phosphorylation | YSTSVTGSREIKSQQ EEEECCCCHHHHCCC | 19.85 | 25159151 | |
18 | Ubiquitination | VTGSREIKSQQSEVT CCCCHHHHCCCCEEE | 37.14 | 23000965 | |
18 | Acetylation | VTGSREIKSQQSEVT CCCCHHHHCCCCEEE | 37.14 | 25953088 | |
19 | Phosphorylation | TGSREIKSQQSEVTR CCCHHHHCCCCEEEH | 38.83 | 29978859 | |
22 | Phosphorylation | REIKSQQSEVTRILD HHHHCCCCEEEHHHC | 26.79 | 26699800 | |
35 | Phosphorylation | LDGKRIQYQLVDISQ HCCCEEEEEEEECCC | 11.05 | 27642862 | |
47 | Methylation | ISQDNALRDEMRALA CCCCHHHHHHHHHHC | 35.12 | 115916837 | |
50 | Sulfoxidation | DNALRDEMRALAGNP CHHHHHHHHHHCCCC | 3.39 | 31801345 | |
58 | Ubiquitination | RALAGNPKATPPQIV HHHCCCCCCCCCCCC | 69.74 | 29967540 | |
60 | Phosphorylation | LAGNPKATPPQIVNG HCCCCCCCCCCCCCC | 41.44 | 29496963 | |
70 | Phosphorylation | QIVNGDQYCGDYELF CCCCCCCCCCCHHHH | 11.79 | 26074081 | |
74 | Phosphorylation | GDQYCGDYELFVEAV CCCCCCCHHHHHHHH | 10.38 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SH3L3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SH3L3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SH3L3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
UBP3_HUMAN | USP3 | physical | 22939629 | |
STXB3_HUMAN | STXBP3 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...