UniProt ID | ARPC3_HUMAN | |
---|---|---|
UniProt AC | O15145 | |
Protein Name | Actin-related protein 2/3 complex subunit 3 | |
Gene Name | ARPC3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization | Cytoplasm, cytoskeleton. Cell projection. | |
Protein Description | Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
Protein Sequence | MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MPAYHSSLMDP ----CCCCCCCCCCC | 9.07 | 21406692 | |
6 | Phosphorylation | --MPAYHSSLMDPDT --CCCCCCCCCCCCC | 16.70 | 21406692 | |
7 | Phosphorylation | -MPAYHSSLMDPDTK -CCCCCCCCCCCCCC | 17.88 | 21406692 | |
13 | Phosphorylation | SSLMDPDTKLIGNMA CCCCCCCCCEECCEE | 32.89 | 20068231 | |
14 | Ubiquitination | SLMDPDTKLIGNMAL CCCCCCCCEECCEEC | 45.55 | 21906983 | |
14 | Sumoylation | SLMDPDTKLIGNMAL CCCCCCCCEECCEEC | 45.55 | 28112733 | |
29 | Methylation | LPIRSQFKGPAPRET EECHHCCCCCCCCCC | 57.24 | - | |
29 | Ubiquitination | LPIRSQFKGPAPRET EECHHCCCCCCCCCC | 57.24 | 21906983 | |
29 | Acetylation | LPIRSQFKGPAPRET EECHHCCCCCCCCCC | 57.24 | 25953088 | |
37 | Acetylation | GPAPRETKDTDIVDE CCCCCCCCCCCHHHH | 54.61 | 20167786 | |
37 | Ubiquitination | GPAPRETKDTDIVDE CCCCCCCCCCCHHHH | 54.61 | 21906983 | |
47 | Phosphorylation | DIVDEAIYYFKANVF CHHHHHHHHHHHCEE | 15.19 | 22115753 | |
48 | Phosphorylation | IVDEAIYYFKANVFF HHHHHHHHHHHCEEE | 7.78 | 28450419 | |
50 | Ubiquitination | DEAIYYFKANVFFKN HHHHHHHHHCEEEEC | 23.95 | 23000965 | |
50 | Acetylation | DEAIYYFKANVFFKN HHHHHHHHHCEEEEC | 23.95 | 20167786 | |
56 | Ubiquitination | FKANVFFKNYEIKNE HHHCEEEECCEECCH | 47.34 | 23000965 | |
56 | Acetylation | FKANVFFKNYEIKNE HHHCEEEECCEECCH | 47.34 | 19608861 | |
56 | 2-Hydroxyisobutyrylation | FKANVFFKNYEIKNE HHHCEEEECCEECCH | 47.34 | - | |
61 | Acetylation | FFKNYEIKNEADRTL EEECCEECCHHHHHH | 36.47 | 19608861 | |
61 | Malonylation | FFKNYEIKNEADRTL EEECCEECCHHHHHH | 36.47 | 26320211 | |
61 | Ubiquitination | FFKNYEIKNEADRTL EEECCEECCHHHHHH | 36.47 | 23000965 | |
81 | Ubiquitination | YISECLKKLQKCNSK HHHHHHHHHHHCCCC | 43.11 | 29967540 | |
88 | Ubiquitination | KLQKCNSKSQGEKEM HHHHCCCCCCCCCEE | 32.57 | 23503661 | |
93 | Ubiquitination | NSKSQGEKEMYTLGI CCCCCCCCEEEEEEE | 55.39 | 33845483 | |
123 | Ubiquitination | IYAKPANKQEDEVMR EEEECCCHHHHHHHH | 58.11 | 33845483 | |
132 | Phosphorylation | EDEVMRAYLQQLRQE HHHHHHHHHHHHHHH | 8.48 | 28152594 | |
146 | Ubiquitination | ETGLRLCEKVFDPQN HHCCHHHHHHCCCCC | 57.77 | 21963094 | |
147 | Ubiquitination | TGLRLCEKVFDPQND HCCHHHHHHCCCCCC | 47.40 | 21963094 | |
147 | Acetylation | TGLRLCEKVFDPQND HCCHHHHHHCCCCCC | 47.40 | 26822725 | |
154 | Ubiquitination | KVFDPQNDKPSKWWT HHCCCCCCCCCHHEE | 60.02 | 32015554 | |
155 | 2-Hydroxyisobutyrylation | VFDPQNDKPSKWWTC HCCCCCCCCCHHEEE | 59.76 | - | |
155 | Ubiquitination | VFDPQNDKPSKWWTC HCCCCCCCCCHHEEE | 59.76 | 32015554 | |
155 | Acetylation | VFDPQNDKPSKWWTC HCCCCCCCCCHHEEE | 59.76 | 23749302 | |
157 | Ubiquitination | DPQNDKPSKWWTCFV CCCCCCCCHHEEEEH | 46.80 | 21963094 | |
158 | Acetylation | PQNDKPSKWWTCFVK CCCCCCCHHEEEEHH | 56.10 | 25953088 | |
158 | Ubiquitination | PQNDKPSKWWTCFVK CCCCCCCHHEEEEHH | 56.10 | 21963094 | |
164 | Ubiquitination | SKWWTCFVKRQFMNK CHHEEEEHHHHHHCH | 5.63 | 23000965 | |
165 | Ubiquitination | KWWTCFVKRQFMNKS HHEEEEHHHHHHCHH | 21.89 | 23000965 | |
165 | Acetylation | KWWTCFVKRQFMNKS HHEEEEHHHHHHCHH | 21.89 | 26051181 | |
170 | Ubiquitination | FVKRQFMNKSLSGPG EHHHHHHCHHCCCCC | 31.86 | 23000965 | |
171 | Ubiquitination | VKRQFMNKSLSGPGQ HHHHHHCHHCCCCCC | 40.77 | 23000965 | |
171 | Acetylation | VKRQFMNKSLSGPGQ HHHHHHCHHCCCCCC | 40.77 | 25953088 | |
172 | Phosphorylation | KRQFMNKSLSGPGQ- HHHHHCHHCCCCCC- | 23.82 | 28102081 | |
174 | Phosphorylation | QFMNKSLSGPGQ--- HHHCHHCCCCCC--- | 50.46 | 24719451 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-56 AND LYS-61, AND MASSSPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-47, AND MASSSPECTROMETRY. | |
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-47, AND MASSSPECTROMETRY. |