UniProt ID | CDN2B_HUMAN | |
---|---|---|
UniProt AC | P42772 | |
Protein Name | Cyclin-dependent kinase 4 inhibitor B | |
Gene Name | CDKN2B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 138 | |
Subcellular Localization | Cytoplasm . Also found in the nucleus. | |
Protein Description | Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.. | |
Protein Sequence | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
74 | S-nitrosocysteine | LHGAEPNCADPATLT HCCCCCCCCCCHHCC | 7.13 | - | |
74 | S-nitrosylation | LHGAEPNCADPATLT HCCCCCCCCCCHHCC | 7.13 | 19483679 | |
101 | Methylation | DTLVVLHRAGARLDV HHHHHHHHCCCCCCH | 30.47 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDN2B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDN2B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDN2B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MAGAB_HUMAN | MAGEA11 | physical | 16189514 | |
ELP1_HUMAN | IKBKAP | physical | 16169070 | |
CC90B_HUMAN | CCDC90B | physical | 16169070 | |
CE126_HUMAN | KIAA1377 | physical | 16169070 | |
A4_HUMAN | APP | physical | 21832049 | |
P5CR3_HUMAN | PYCRL | physical | 23718855 | |
ISL1_HUMAN | ISL1 | physical | 21988832 | |
TGFI1_HUMAN | TGFB1I1 | physical | 21988832 | |
TRAF1_HUMAN | TRAF1 | physical | 25416956 | |
NIF3L_HUMAN | NIF3L1 | physical | 25416956 | |
CCD33_HUMAN | CCDC33 | physical | 25416956 | |
CDK6_HUMAN | CDK6 | physical | 26578655 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...