UniProt ID | P5CR3_HUMAN | |
---|---|---|
UniProt AC | Q53H96 | |
Protein Name | Pyrroline-5-carboxylate reductase 3 {ECO:0000312|HGNC:HGNC:25846} | |
Gene Name | PYCR3 {ECO:0000312|HGNC:HGNC:25846} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 274 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Enzyme that catalyzes the last step in proline biosynthesis. Proline is synthesized from either glutamate or ornithine; both are converted to pyrroline-5-carboxylate (P5C), and then to proline via pyrroline-5-carboxylate reductases (PYCRs). PYCRL is exclusively linked to the conversion of ornithine to proline.. | |
Protein Sequence | MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAAEPSPR ------CCCCCCCCC | 18.51 | 22814378 | |
7 | Phosphorylation | -MAAAEPSPRRVGFV -CCCCCCCCCCCCCC | 23.65 | 29255136 | |
32 | Malonylation | QGLIRAGKVEAQHIL HHHHHCCCCCHHHHH | 35.60 | 26320211 | |
32 | Ubiquitination | QGLIRAGKVEAQHIL HHHHHCCCCCHHHHH | 35.60 | - | |
39 | Ubiquitination | KVEAQHILASAPTDR CCCHHHHHHCCCCCC | 2.64 | - | |
44 | Ubiquitination | HILASAPTDRNLCHF HHHHCCCCCCCCCCH | 47.51 | - | |
129 | Glutathionylation | RVLPNLPCVVQEGAI EECCCCCEEEECCEE | 5.44 | 22555962 | |
146 | Phosphorylation | ARGRHVGSSETKLLQ ECCCCCCCHHHHHHH | 24.74 | 29083192 | |
147 | Phosphorylation | RGRHVGSSETKLLQH CCCCCCCHHHHHHHH | 42.38 | 20071362 | |
149 | Phosphorylation | RHVGSSETKLLQHLL CCCCCHHHHHHHHHH | 32.87 | 29083192 | |
159 | Phosphorylation | LQHLLEACGRCEEVP HHHHHHHCCCCCCCC | 2.29 | - | |
202 | Phosphorylation | AVKMGMPSSLAHRIA HHHCCCCHHHHHHHH | 29.14 | 23403867 | |
203 | Phosphorylation | VKMGMPSSLAHRIAA HHCCCCHHHHHHHHH | 24.57 | 23403867 | |
212 | Phosphorylation | AHRIAAQTLLGTAKM HHHHHHHHHHHHHHH | 21.15 | 20068231 | |
216 | Phosphorylation | AAQTLLGTAKMLLHE HHHHHHHHHHHHHHC | 24.07 | 20068231 | |
218 | Ubiquitination | QTLLGTAKMLLHEGQ HHHHHHHHHHHHCCC | 29.89 | 21906983 | |
228 | Phosphorylation | LHEGQHPAQLRSDVC HHCCCCHHHHCCCEE | 20.93 | 20068231 | |
230 | Ubiquitination | EGQHPAQLRSDVCTP CCCCHHHHCCCEECC | 6.51 | - | |
232 | Phosphorylation | QHPAQLRSDVCTPGG CCHHHHCCCEECCCC | 42.88 | 23312004 | |
235 | Glutathionylation | AQLRSDVCTPGGTTI HHHCCCEECCCCCEE | 4.57 | 22555962 | |
236 | Phosphorylation | QLRSDVCTPGGTTIY HHCCCEECCCCCEEE | 25.47 | 23312004 | |
240 | Phosphorylation | DVCTPGGTTIYGLHA CEECCCCCEEECHHH | 18.88 | 20071362 | |
241 | Phosphorylation | VCTPGGTTIYGLHAL EECCCCCEEECHHHH | 18.57 | 20071362 | |
243 | Phosphorylation | TPGGTTIYGLHALEQ CCCCCEEECHHHHHH | 16.14 | 23312004 | |
248 | Phosphorylation | TIYGLHALEQGGLRA EEECHHHHHHCCCCH | 3.34 | 24719451 | |
257 | Phosphorylation | QGGLRAATMSAVEAA HCCCCHHHHHHHHHH | 15.63 | 28857561 | |
266 | Glutathionylation | SAVEAATCRAKELSR HHHHHHHHHHHHHHC | 3.23 | 22555962 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P5CR3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P5CR3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P5CR3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDN2B_HUMAN | CDKN2B | physical | 23718855 | |
ANM6_HUMAN | PRMT6 | physical | 23455924 | |
P5CR3_HUMAN | PYCRL | physical | 25416956 | |
GPD1L_HUMAN | GPD1L | physical | 26344197 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00172 | L-Proline |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |