UniProt ID | ARP5L_HUMAN | |
---|---|---|
UniProt AC | Q9BPX5 | |
Protein Name | Actin-related protein 2/3 complex subunit 5-like protein | |
Gene Name | ARPC5L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 153 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | May function as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
Protein Sequence | MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Methylation | -----MARNTLSSRF -----CCCCHHHHHH | 35.05 | - | |
5 | Phosphorylation | ---MARNTLSSRFRR ---CCCCHHHHHHHC | 23.59 | 29414761 | |
7 | Phosphorylation | -MARNTLSSRFRRVD -CCCCHHHHHHHCCC | 19.89 | 25056879 | |
7 | O-linked_Glycosylation | -MARNTLSSRFRRVD -CCCCHHHHHHHCCC | 19.89 | 30379171 | |
22 | Ubiquitination | IDEFDENKFVDEQEE HHHCCCCCCCCHHHH | 44.72 | 21906983 | |
64 | Phosphorylation | FHAALRNSPVNTKNQ HHHHHHCCCCCCCCH | 24.64 | 25159151 | |
68 | Phosphorylation | LRNSPVNTKNQAVKE HHCCCCCCCCHHHHH | 31.44 | 23927012 | |
69 | Ubiquitination | RNSPVNTKNQAVKER HCCCCCCCCHHHHHH | 41.69 | 21906983 | |
83 | Ubiquitination | RAQGVVLKVLTNFKS HHHHHHHHHHHHCCH | 24.48 | - | |
86 | Phosphorylation | GVVLKVLTNFKSSEI HHHHHHHHHCCHHHH | 41.41 | 27251275 | |
89 | Ubiquitination | LKVLTNFKSSEIEQA HHHHHHCCHHHHHHH | 55.96 | 21906983 | |
90 | Phosphorylation | KVLTNFKSSEIEQAV HHHHHCCHHHHHHHH | 29.12 | 25307156 | |
91 | Phosphorylation | VLTNFKSSEIEQAVQ HHHHCCHHHHHHHHH | 43.09 | 21406692 | |
99 | Phosphorylation | EIEQAVQSLDRNGVD HHHHHHHHCHHCCHH | 26.16 | 21406692 | |
110 | Ubiquitination | NGVDLLMKYIYKGFE CCHHHHHHHHHHCCC | 28.59 | 21906983 | |
114 | Ubiquitination | LLMKYIYKGFEKPTE HHHHHHHHCCCCCCC | 47.79 | - | |
118 | Acetylation | YIYKGFEKPTENSSA HHHHCCCCCCCCCCC | 55.78 | 26051181 | |
118 | Ubiquitination | YIYKGFEKPTENSSA HHHHCCCCCCCCCCC | 55.78 | - | |
142 | Phosphorylation | LAVGGLGSIIRVLTA HHHCCHHHHHHHHHH | 21.64 | 21712546 | |
148 | Phosphorylation | GSIIRVLTARKTV-- HHHHHHHHHCCCC-- | 22.89 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARP5L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARP5L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARP5L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARPC4_HUMAN | ARPC4 | physical | 16169070 | |
ARPC4_HUMAN | ARPC4 | physical | 22939629 | |
ARPC2_HUMAN | ARPC2 | physical | 22939629 | |
ARPC3_HUMAN | ARPC3 | physical | 22939629 | |
GA45G_HUMAN | GADD45G | physical | 21988832 | |
ARPC2_HUMAN | ARPC2 | physical | 22863883 | |
ARPC3_HUMAN | ARPC3 | physical | 22863883 | |
ARPC4_HUMAN | ARPC4 | physical | 22863883 | |
ARPC5_HUMAN | ARPC5 | physical | 22863883 | |
KAPCA_HUMAN | PRKACA | physical | 22863883 | |
TM10A_HUMAN | TRMT10A | physical | 22863883 | |
SH3G1_HUMAN | SH3GL1 | physical | 22863883 | |
ARP3_HUMAN | ACTR3 | physical | 26344197 | |
ARC1A_HUMAN | ARPC1A | physical | 26344197 | |
ARPC2_HUMAN | ARPC2 | physical | 26344197 | |
ARPC4_HUMAN | ARPC4 | physical | 26344197 | |
CAPZB_HUMAN | CAPZB | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64, AND MASSSPECTROMETRY. |