BEX3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BEX3_HUMAN
• UniProt AC: Q00994
• Protein Name: Protein BEX3 {ECO:0000305}
• Gene Name: BEX3 {ECO:0000312|HGNC:HGNC:13388}
• Organism: Homo sapiens (Human).
• Sequence Length: 111
• Subcellular Localization: Nucleus. Cytoplasm. Shuttles between the cytoplasm and the nucleus. Associates with replicating mitochondria (By similarity)..
• Protein Description: May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases..
• Protein Sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
80	Ubiquitination	EMREIRRKLRELQLR HHHHHHHHHHHHHHH	41.89	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BEX3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BEX3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BEX3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VTA1_HUMAN	VTA1	physical	21988832
SIVA_HUMAN	SIVA1	physical	21988832
BEX3_HUMAN	NGFRAP1	physical	25416956
NECA2_HUMAN	NECAB2	physical	25416956
CTBL1_HUMAN	CTNNBL1	physical	25416956
USBP1_HUMAN	USHBP1	physical	25416956
FSD2_HUMAN	FSD2	physical	25416956
CC116_HUMAN	CCDC116	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.