| UniProt ID | BEX3_HUMAN | |
|---|---|---|
| UniProt AC | Q00994 | |
| Protein Name | Protein BEX3 {ECO:0000305} | |
| Gene Name | BEX3 {ECO:0000312|HGNC:HGNC:13388} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 111 | |
| Subcellular Localization | Nucleus. Cytoplasm. Shuttles between the cytoplasm and the nucleus. Associates with replicating mitochondria (By similarity).. | |
| Protein Description | May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.. | |
| Protein Sequence | MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 80 | Ubiquitination | EMREIRRKLRELQLR HHHHHHHHHHHHHHH | 41.89 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BEX3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BEX3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BEX3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VTA1_HUMAN | VTA1 | physical | 21988832 | |
| SIVA_HUMAN | SIVA1 | physical | 21988832 | |
| BEX3_HUMAN | NGFRAP1 | physical | 25416956 | |
| NECA2_HUMAN | NECAB2 | physical | 25416956 | |
| CTBL1_HUMAN | CTNNBL1 | physical | 25416956 | |
| USBP1_HUMAN | USHBP1 | physical | 25416956 | |
| FSD2_HUMAN | FSD2 | physical | 25416956 | |
| CC116_HUMAN | CCDC116 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...