| UniProt ID | VTA1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NP79 | |
| Protein Name | Vacuolar protein sorting-associated protein VTA1 homolog | |
| Gene Name | VTA1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 307 | |
| Subcellular Localization |
Cytoplasm . Endosome membrane Peripheral membrane protein . |
|
| Protein Description | Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies. Involved in the sorting and down-regulation of EGFR (By similarity). Involved in HIV-1 budding.. | |
| Protein Sequence | MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALKLLTTGRE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAALAPLPP ------CCCCCCCCC | 15.93 | 22223895 | |
| 15 | Acetylation | PPLPAQFKSIQHHLR CCCCHHHHHHHHHHH | 34.27 | 25953088 | |
| 22 | Methylation | KSIQHHLRTAQEHDK HHHHHHHHHHHHHCC | 24.53 | 115919869 | |
| 43 | Sulfoxidation | YYCRLYAMQTGMKID HHHHHHHHHHCCCCC | 2.01 | 30846556 | |
| 47 | Sulfoxidation | LYAMQTGMKIDSKTP HHHHHHCCCCCCCCH | 3.79 | 30846556 | |
| 52 | 2-Hydroxyisobutyrylation | TGMKIDSKTPECRKF HCCCCCCCCHHHHHH | 65.44 | - | |
| 62 | Acetylation | ECRKFLSKLMDQLEA HHHHHHHHHHHHHHH | 50.40 | 25953088 | |
| 64 | Sulfoxidation | RKFLSKLMDQLEALK HHHHHHHHHHHHHHH | 3.38 | 21406390 | |
| 71 | Acetylation | MDQLEALKKQLGDNE HHHHHHHHHHHCCCH | 45.59 | 25953088 | |
| 71 | 2-Hydroxyisobutyrylation | MDQLEALKKQLGDNE HHHHHHHHHHHCCCH | 45.59 | - | |
| 72 | Ubiquitination | DQLEALKKQLGDNEA HHHHHHHHHHCCCHH | 52.16 | - | |
| 150 | Phosphorylation | KYARWKATYIHNCLK HHHHHHHHHHHHHHH | 21.20 | 28152594 | |
| 151 | Phosphorylation | YARWKATYIHNCLKN HHHHHHHHHHHHHHC | 12.68 | 28152594 | |
| 155 | S-nitrosocysteine | KATYIHNCLKNGETP HHHHHHHHHHCCCCC | 3.37 | - | |
| 155 | S-nitrosylation | KATYIHNCLKNGETP HHHHHHHHHHCCCCC | 3.37 | 19483679 | |
| 242 | O-linked_Glycosylation | ASNTIQPTPQTIPAI CCCCCCCCCCCCCCC | 16.20 | OGP | |
| 258 | O-linked_Glycosylation | PALFNTISQGDVRLT HHHHCCCCCCCCCCC | 26.52 | 30379171 | |
| 265 | Phosphorylation | SQGDVRLTPEDFARA CCCCCCCCHHHHHHH | 17.67 | 21815630 | |
| 277 | Ubiquitination | ARAQKYCKYAGSALQ HHHHHHHHHCCCCCC | 34.74 | - | |
| 277 | Malonylation | ARAQKYCKYAGSALQ HHHHHHHHHCCCCCC | 34.74 | 26320211 | |
| 277 | Acetylation | ARAQKYCKYAGSALQ HHHHHHHHHCCCCCC | 34.74 | 25953088 | |
| 278 | Phosphorylation | RAQKYCKYAGSALQY HHHHHHHHCCCCCCH | 16.78 | 21945579 | |
| 281 | Phosphorylation | KYCKYAGSALQYEDV HHHHHCCCCCCHHCH | 20.03 | 21945579 | |
| 285 | Phosphorylation | YAGSALQYEDVSTAV HCCCCCCHHCHHHHH | 18.23 | 21945579 | |
| 289 | Phosphorylation | ALQYEDVSTAVQNLQ CCCHHCHHHHHHHHH | 23.99 | 21945579 | |
| 290 | Phosphorylation | LQYEDVSTAVQNLQK CCHHCHHHHHHHHHH | 30.60 | 21945579 | |
| 300 | Acetylation | QNLQKALKLLTTGRE HHHHHHHHHHHCCCC | 46.43 | 25953088 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VTA1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VTA1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VTA1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BACD1_HUMAN | KCTD13 | physical | 16189514 | |
| NECA2_HUMAN | NECAB2 | physical | 16189514 | |
| MBIP1_HUMAN | MBIP | physical | 16189514 | |
| KLH12_HUMAN | KLHL12 | physical | 16189514 | |
| DPPA2_HUMAN | DPPA2 | physical | 16189514 | |
| CHMP5_HUMAN | CHMP5 | physical | 21543490 | |
| CHM2A_HUMAN | CHMP2A | physical | 21543490 | |
| CHMP3_HUMAN | CHMP3 | physical | 21543490 | |
| A4_HUMAN | APP | physical | 21832049 | |
| XPP1_HUMAN | XPNPEP1 | physical | 22939629 | |
| VATC1_HUMAN | ATP6V1C1 | physical | 22863883 | |
| SRC8_HUMAN | CTTN | physical | 22863883 | |
| MAOX_HUMAN | ME1 | physical | 22863883 | |
| SYDC_HUMAN | DARS | physical | 26344197 | |
| DLDH_HUMAN | DLD | physical | 26344197 | |
| MK03_HUMAN | MAPK3 | physical | 26344197 | |
| XPP1_HUMAN | XPNPEP1 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |