UniProt ID | CS025_HUMAN | |
---|---|---|
UniProt AC | Q9UFG5 | |
Protein Name | UPF0449 protein C19orf25 | |
Gene Name | C19orf25 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 118 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Phosphorylation | EAPGEQLYQQSRAYV CCCHHHHHHHHHHHH | 12.28 | 28796482 | |
66 | Phosphorylation | GEQLYQQSRAYVAAN HHHHHHHHHHHHHHH | 11.89 | 28796482 | |
105 | Ubiquitination | EREVAQMKQAALPAA HHHHHHHHHHHHHHH | 25.38 | 24816145 | |
116 | Phosphorylation | LPAAEAASSG----- HHHHHHHHCC----- | 42.51 | 27251275 | |
117 | Phosphorylation | PAAEAASSG------ HHHHHHHCC------ | 43.74 | 27251275 | |
148 | Ubiquitination | ------------------------------------- ------------------------------------- | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CS025_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CS025_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CS025_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CSN9_HUMAN | MYEOV2 | physical | 22939629 | |
DUT_HUMAN | DUT | physical | 22939629 | |
HNRH2_HUMAN | HNRNPH2 | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...