CS025_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CS025_HUMAN
• UniProt AC: Q9UFG5
• Protein Name: UPF0449 protein C19orf25
• Gene Name: C19orf25
• Organism: Homo sapiens (Human).
• Sequence Length: 118
• Protein Sequence: MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
63	Phosphorylation	EAPGEQLYQQSRAYV CCCHHHHHHHHHHHH	12.28	28796482
66	Phosphorylation	GEQLYQQSRAYVAAN HHHHHHHHHHHHHHH	11.89	28796482
105	Ubiquitination	EREVAQMKQAALPAA HHHHHHHHHHHHHHH	25.38	24816145
116	Phosphorylation	LPAAEAASSG----- HHHHHHHHCC-----	42.51	27251275
117	Phosphorylation	PAAEAASSG------ HHHHHHHCC------	43.74	27251275
148	Ubiquitination	------------------------------------- -------------------------------------		24816145

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CS025_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CS025_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CS025_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN9_HUMAN	MYEOV2	physical	22939629
DUT_HUMAN	DUT	physical	22939629
HNRH2_HUMAN	HNRNPH2	physical	22939629

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.