RPA12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPA12_HUMAN
• UniProt AC: Q9P1U0
• Protein Name: DNA-directed RNA polymerase I subunit RPA12
• Gene Name: ZNRD1
• Organism: Homo sapiens (Human).
• Sequence Length: 126
• Subcellular Localization: Nucleus, nucleolus .
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors..
• Protein Sequence: MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RPA12_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPA12_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPA12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPA12_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZN593_HUMAN	ZNF593	physical	20211142
RPAB1_HUMAN	POLR2E	physical	26344197
RPAB3_HUMAN	POLR2H	physical	26344197

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.