UniProt ID | MED28_HUMAN | |
---|---|---|
UniProt AC | Q9H204 | |
Protein Name | Mediator of RNA polymerase II transcription subunit 28 | |
Gene Name | MED28 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization |
Nucleus . Cytoplasm . Membrane Peripheral membrane protein . According to PubMed:15467741, it is cytoplasmic and mainly membrane-associated. |
|
Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways.. | |
Protein Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Phosphorylation | ASLVSQDYVNGTDQE HHHHCCHHCCCCCHH | 6.54 | 22817900 | |
83 | Ubiquitination | GVDQCIQKFLDIARQ CHHHHHHHHHHHHHH | 28.16 | 22053931 | |
98 | Ubiquitination | TECFFLQKRLQLSVQ HHHHHHHHHHCHHCC | 58.17 | - | |
98 | Acetylation | TECFFLQKRLQLSVQ HHHHHHHHHHCHHCC | 58.17 | 25953088 | |
106 | Acetylation | RLQLSVQKPEQVIKE HHCHHCCCHHHHHHH | 48.65 | 26051181 | |
125 | Ubiquitination | LRNELQRKDALVQKH HHHHHHHHHHHHHHH | 34.10 | 29967540 | |
131 | Ubiquitination | RKDALVQKHLTKLRH HHHHHHHHHHHHHHH | 32.86 | 29967540 | |
134 | Phosphorylation | ALVQKHLTKLRHWQQ HHHHHHHHHHHHHHH | 27.96 | 29449344 | |
160 | Phosphorylation | PADIPQGSLAYLEQA CCCCCCCHHHHHHHH | 12.46 | 28555341 | |
176 | Acetylation | ANIPAPLKPT----- CCCCCCCCCC----- | 45.62 | 19608861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
64 | Y | Phosphorylation | Kinase | LCK | P06239 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED28_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED28_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...