UniProt ID | PHS2_HUMAN | |
---|---|---|
UniProt AC | Q9H0N5 | |
Protein Name | Pterin-4-alpha-carbinolamine dehydratase 2 | |
Gene Name | PCBD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 130 | |
Subcellular Localization | ||
Protein Description | Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2 (By similarity).; Regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity.. | |
Protein Sequence | MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | VLGALGATRRLLAAL HHHHHHHHHHHHHHH | 17.96 | 21406692 | |
86 | Acetylation | RVALQAEKMNHHPEW HHHHHHHHCCCCCHH | 48.28 | 25953088 | |
106 | Phosphorylation | KVQITLTSHDCGELT HHEEEEEECCCCCCC | 22.05 | 28509920 | |
113 | Phosphorylation | SHDCGELTKKDVKLA ECCCCCCCHHHHHHH | 31.57 | 28509920 | |
114 | Acetylation | HDCGELTKKDVKLAK CCCCCCCHHHHHHHH | 60.65 | - | |
114 | Succinylation | HDCGELTKKDVKLAK CCCCCCCHHHHHHHH | 60.65 | - | |
114 | Succinylation | HDCGELTKKDVKLAK CCCCCCCHHHHHHHH | 60.65 | - | |
118 | Acetylation | ELTKKDVKLAKFIEK CCCHHHHHHHHHHHH | 53.51 | - | |
118 | Succinylation | ELTKKDVKLAKFIEK CCCHHHHHHHHHHHH | 53.51 | - | |
118 | Succinylation | ELTKKDVKLAKFIEK CCCHHHHHHHHHHHH | 53.51 | - | |
121 | Acetylation | KKDVKLAKFIEKAAA HHHHHHHHHHHHHHH | 58.26 | 25953088 | |
125 | Acetylation | KLAKFIEKAAASV-- HHHHHHHHHHHCC-- | 38.21 | 27178108 | |
125 | Succinylation | KLAKFIEKAAASV-- HHHHHHHHHHHCC-- | 38.21 | - | |
125 | Succinylation | KLAKFIEKAAASV-- HHHHHHHHHHHCC-- | 38.21 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHS2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHS2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHS2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ASCC2_HUMAN | ASCC2 | physical | 20211142 | |
MED30_HUMAN | MED30 | physical | 20211142 | |
TF2LY_HUMAN | TGIF2LY | physical | 20211142 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-125, AND MASS SPECTROMETRY. |