| UniProt ID | PP2AB_HUMAN | |
|---|---|---|
| UniProt AC | P62714 | |
| Protein Name | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform | |
| Gene Name | PPP2CB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 309 | |
| Subcellular Localization | Cytoplasm . Nucleus . Chromosome, centromere . Cytoplasm, cytoskeleton, spindle pole . In prometaphase cells, but not in anaphase cells, localizes at centromeres. During mitosis, also found at spindle poles. | |
| Protein Description | PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.. | |
| Protein Sequence | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Ubiquitination | ----MDDKAFTKELD ----CCHHHHHHHHH | 40.93 | - | |
| 8 | Ubiquitination | MDDKAFTKELDQWVE CCHHHHHHHHHHHHH | 50.23 | - | |
| 21 | Ubiquitination | VEQLNECKQLNENQV HHHHHHHHHCCHHHH | 52.20 | 21890473 | |
| 21 | Ubiquitination | VEQLNECKQLNENQV HHHHHHHHHCCHHHH | 52.20 | 21890473 | |
| 34 | Ubiquitination | QVRTLCEKAKEILTK HHHHHHHHHHHHHHC | 64.86 | - | |
| 36 | Ubiquitination | RTLCEKAKEILTKES HHHHHHHHHHHHCCC | 57.25 | 21890473 | |
| 41 | Ubiquitination | KAKEILTKESNVQEV HHHHHHHCCCCCCEE | 56.55 | 21890473 | |
| 41 | Acetylation | KAKEILTKESNVQEV HHHHHHHCCCCCCEE | 56.55 | 25953088 | |
| 41 | Ubiquitination | KAKEILTKESNVQEV HHHHHHHCCCCCCEE | 56.55 | 21890473 | |
| 43 | Phosphorylation | KEILTKESNVQEVRC HHHHHCCCCCCEEEC | 43.80 | 26437602 | |
| 74 | Ubiquitination | ELFRIGGKSPDTNYL HHHHCCCCCCCCCEE | 54.31 | 21890473 | |
| 75 | Phosphorylation | LFRIGGKSPDTNYLF HHHCCCCCCCCCEEE | 31.14 | 21712546 | |
| 78 | Phosphorylation | IGGKSPDTNYLFMGD CCCCCCCCCEEECCC | 29.19 | - | |
| 83 | Sulfoxidation | PDTNYLFMGDYVDRG CCCCEEECCCCCCCC | 3.54 | 30846556 | |
| 86 | Phosphorylation | NYLFMGDYVDRGYYS CEEECCCCCCCCCEE | 9.87 | - | |
| 124 | Phosphorylation | NHESRQITQVYGFYD CCCHHHHHEEEEHHH | 12.02 | 24043423 | |
| 127 | Phosphorylation | SRQITQVYGFYDECL HHHHHEEEEHHHHHH | 7.53 | 28152594 | |
| 130 | Phosphorylation | ITQVYGFYDECLRKY HHEEEEHHHHHHHHH | 13.38 | 28152594 | |
| 136 | Ubiquitination | FYDECLRKYGNANVW HHHHHHHHHCCCCHH | 44.56 | 21890473 | |
| 136 | Acetylation | FYDECLRKYGNANVW HHHHHHHHHCCCCHH | 44.56 | 26051181 | |
| 195 | Sulfoxidation | EVPHEGPMCDLLWSD CCCCCCCCCCEECCC | 4.00 | 30846556 | |
| 212 | Phosphorylation | DRGGWGISPRGAGYT CCCCCCCCCCCCCCC | 12.47 | 26074081 | |
| 218 | Phosphorylation | ISPRGAGYTFGQDIS CCCCCCCCCCCCCHH | 9.81 | 26074081 | |
| 219 | Phosphorylation | SPRGAGYTFGQDISE CCCCCCCCCCCCHHH | 22.00 | 26074081 | |
| 225 | Phosphorylation | YTFGQDISETFNHAN CCCCCCHHHHHHHCC | 38.58 | 26074081 | |
| 245 | Sulfoxidation | SRAHQLVMEGYNWCH HHHHHHHHCCCCCCC | 4.49 | 30846556 | |
| 248 | Phosphorylation | HQLVMEGYNWCHDRN HHHHHCCCCCCCCCC | 7.68 | 24927040 | |
| 265 | Phosphorylation | TIFSAPNYCYRCGNQ EEEECCCCHHHCCCE | 6.98 | 20090780 | |
| 267 | Phosphorylation | FSAPNYCYRCGNQAA EECCCCHHHCCCEEE | 9.89 | 28152594 | |
| 283 | Ubiquitination | MELDDTLKYSFLQFD EECCCCCEEEEEECC | 40.72 | 21890473 | |
| 284 | Phosphorylation | ELDDTLKYSFLQFDP ECCCCCEEEEEECCC | 14.04 | 28796482 | |
| 285 | Phosphorylation | LDDTLKYSFLQFDPA CCCCCEEEEEECCCC | 20.21 | 28796482 | |
| 295 | Methylation | QFDPAPRRGEPHVTR ECCCCCCCCCCCCCC | 53.41 | - | |
| 301 | Phosphorylation | RRGEPHVTRRTPDYF CCCCCCCCCCCCCCC | 16.05 | 29214152 | |
| 304 | Phosphorylation | EPHVTRRTPDYFL-- CCCCCCCCCCCCC-- | 19.74 | 30266825 | |
| 307 | Phosphorylation | VTRRTPDYFL----- CCCCCCCCCC----- | 14.16 | 28152594 | |
| 309 | Methylation | RRTPDYFL------- CCCCCCCC------- | 5.81 | 8206937 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2AB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2AB_HUMAN !! | ||||||
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00163 | Vitamin E |
loading...