MLRS_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MLRS_HUMAN
• UniProt AC: Q96A32
• Protein Name: Myosin regulatory light chain 2, skeletal muscle isoform
• Gene Name: MYLPF {ECO:0000250|UniProtKB:P97457}
• Organism: Homo sapiens (Human).
• Sequence Length: 169
• Protein Sequence: MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Methylation	------MAPKRAKRR ------CCCCCCCCC	20.51	-
10	Phosphorylation	PKRAKRRTVEGGSSS CCCCCCCCCCCCCCH	27.26	19764811
15	Phosphorylation	RRTVEGGSSSVFSMF CCCCCCCCCHHHHCC	30.23	19764811
16	Phosphorylation	RTVEGGSSSVFSMFD CCCCCCCCHHHHCCC	33.52	19764811
17	Phosphorylation	TVEGGSSSVFSMFDQ CCCCCCCHHHHCCCH	28.95	19764811
20	Phosphorylation	GGSSSVFSMFDQTQI CCCCHHHHCCCHHHH	19.18	22673903
25	Phosphorylation	VFSMFDQTQIQEFKE HHHCCCHHHHHHHHH	29.50	22673903
35	Phosphorylation	QEFKEAFTVIDQNRD HHHHHHHHHHCCCCC	24.49	26437602
75	Phosphorylation	DAMMKEASGPINFTV HHHHHHCCCCEEEEE	46.31	20068231
81	Phosphorylation	ASGPINFTVFLTMFG CCCCEEEEEEEHHHH	13.08	20068231
85	Phosphorylation	INFTVFLTMFGEKLK EEEEEEEHHHHHHHC	10.05	20068231
101	Phosphorylation	ADPEDVITGAFKVLD CCHHHHHCCEEEEEC	23.47	20068231
105	Acetylation	DVITGAFKVLDPEGK HHHCCEEEEECCCCC	41.16	12430159
132	Phosphorylation	TTQCDRFSQEEIKNM HHCCHHCCHHHHHHH	37.26	26437602
158	Phosphorylation	VDYKNICYVITHGDA CCCCCEEEEEECCCC	7.35	19764811
161	Phosphorylation	KNICYVITHGDAKDQ CCEEEEEECCCCCCC	15.12	22673903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	TRIM63	Q969Q1	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MLRS_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MLRS_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MLRS_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.