| UniProt ID | ZN775_HUMAN | |
|---|---|---|
| UniProt AC | Q96BV0 | |
| Protein Name | Zinc finger protein 775 | |
| Gene Name | ZNF775 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 537 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MESGLAGNGTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSGEGHFVCLDCGKRFSWWSSLKIHQRTHTGEKPYLCGKCGKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLKHQKTHSRPATHSCPECERCFRHQVGLRIHQRAHARDRQGSRAGLHELIQDAAARRACRLQPGPPRGRPEWAWLGLCQGWWGQPGARAAVSGPEGPGEPRQFICNECGKSFTWWSSLNIHQRIHTGERPYACPECGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQHLLKHLRTHLPGAQAAPCPSCGKSCRSRAALRAHQRAHAVAEPAVPAGEPGDQPQAEAIPGLAARPRSSQRSPGARDTLWGRGQAGLAGPGEPRQFICNECGKSFSWWSALTIHQRIHTGERPYPCPECGRRFSQKPNLTRHRRNHTGERPYLCPACGRGFSQKQHLLKHQRVHRAAPACSPKEEAR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MESGLAGNGT -----CCCCCCCCCC | 37.50 | 23403867 | |
| 10 | Phosphorylation | SGLAGNGTGAGLVMK CCCCCCCCCCCCEEE | 28.05 | 23403867 | |
| 41 | Sumoylation | AMLVEKDKENIFQQH HHHHHHHHHHHHHHH | 64.82 | - | |
| 41 | Sumoylation | AMLVEKDKENIFQQH HHHHHHHHHHHHHHH | 64.82 | - | |
| 69 | Phosphorylation | ALGGQEESGSPRWAP CCCCCCCCCCCCCCC | 43.76 | 29255136 | |
| 71 | Phosphorylation | GGQEESGSPRWAPPT CCCCCCCCCCCCCCC | 22.14 | 29255136 | |
| 128 | Phosphorylation | SLKIHQRTHTGEKPY HCEEECCCCCCCCCE | 19.74 | - | |
| 130 | Phosphorylation | KIHQRTHTGEKPYLC EEECCCCCCCCCEEC | 46.56 | - | |
| 133 | Acetylation | QRTHTGEKPYLCGKC CCCCCCCCCEECCCC | 40.06 | 7428861 | |
| 304 | Phosphorylation | NIHQRIHTGERPYAC CHHHHCCCCCCCCCC | 38.06 | 17081983 | |
| 319 | Phosphorylation | PECGRRFSQKPNLTR CCCCCCCCCCCCHHH | 35.17 | 28555341 | |
| 418 | Phosphorylation | GLAARPRSSQRSPGA CCCCCCCCCCCCCCC | 33.24 | 24144214 | |
| 419 | Phosphorylation | LAARPRSSQRSPGAR CCCCCCCCCCCCCCC | 30.78 | 24275748 | |
| 422 | Phosphorylation | RPRSSQRSPGARDTL CCCCCCCCCCCCCCC | 21.76 | 24144214 | |
| 484 | Phosphorylation | PECGRRFSQKPNLTR CCCCCCCCCCCCCCC | 35.17 | 28555341 | |
| 531 | Phosphorylation | HRAAPACSPKEEAR- HHCCCCCCHHHHCC- | 40.90 | 30624053 | |
| 533 | Sumoylation | AAPACSPKEEAR--- CCCCCCHHHHCC--- | 52.47 | 28112733 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN775_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN775_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN775_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZN775_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-304, AND MASSSPECTROMETRY. | |
