UniProt ID | ZN775_HUMAN | |
---|---|---|
UniProt AC | Q96BV0 | |
Protein Name | Zinc finger protein 775 | |
Gene Name | ZNF775 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 537 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MESGLAGNGTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSGEGHFVCLDCGKRFSWWSSLKIHQRTHTGEKPYLCGKCGKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLKHQKTHSRPATHSCPECERCFRHQVGLRIHQRAHARDRQGSRAGLHELIQDAAARRACRLQPGPPRGRPEWAWLGLCQGWWGQPGARAAVSGPEGPGEPRQFICNECGKSFTWWSSLNIHQRIHTGERPYACPECGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQHLLKHLRTHLPGAQAAPCPSCGKSCRSRAALRAHQRAHAVAEPAVPAGEPGDQPQAEAIPGLAARPRSSQRSPGARDTLWGRGQAGLAGPGEPRQFICNECGKSFSWWSALTIHQRIHTGERPYPCPECGRRFSQKPNLTRHRRNHTGERPYLCPACGRGFSQKQHLLKHQRVHRAAPACSPKEEAR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MESGLAGNGT -----CCCCCCCCCC | 37.50 | 23403867 | |
10 | Phosphorylation | SGLAGNGTGAGLVMK CCCCCCCCCCCCEEE | 28.05 | 23403867 | |
41 | Sumoylation | AMLVEKDKENIFQQH HHHHHHHHHHHHHHH | 64.82 | - | |
41 | Sumoylation | AMLVEKDKENIFQQH HHHHHHHHHHHHHHH | 64.82 | - | |
69 | Phosphorylation | ALGGQEESGSPRWAP CCCCCCCCCCCCCCC | 43.76 | 29255136 | |
71 | Phosphorylation | GGQEESGSPRWAPPT CCCCCCCCCCCCCCC | 22.14 | 29255136 | |
128 | Phosphorylation | SLKIHQRTHTGEKPY HCEEECCCCCCCCCE | 19.74 | - | |
130 | Phosphorylation | KIHQRTHTGEKPYLC EEECCCCCCCCCEEC | 46.56 | - | |
133 | Acetylation | QRTHTGEKPYLCGKC CCCCCCCCCEECCCC | 40.06 | 7428861 | |
304 | Phosphorylation | NIHQRIHTGERPYAC CHHHHCCCCCCCCCC | 38.06 | 17081983 | |
319 | Phosphorylation | PECGRRFSQKPNLTR CCCCCCCCCCCCHHH | 35.17 | 28555341 | |
418 | Phosphorylation | GLAARPRSSQRSPGA CCCCCCCCCCCCCCC | 33.24 | 24144214 | |
419 | Phosphorylation | LAARPRSSQRSPGAR CCCCCCCCCCCCCCC | 30.78 | 24275748 | |
422 | Phosphorylation | RPRSSQRSPGARDTL CCCCCCCCCCCCCCC | 21.76 | 24144214 | |
484 | Phosphorylation | PECGRRFSQKPNLTR CCCCCCCCCCCCCCC | 35.17 | 28555341 | |
531 | Phosphorylation | HRAAPACSPKEEAR- HHCCCCCCHHHHCC- | 40.90 | 30624053 | |
533 | Sumoylation | AAPACSPKEEAR--- CCCCCCHHHHCC--- | 52.47 | 28112733 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN775_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN775_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN775_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZN775_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-304, AND MASSSPECTROMETRY. |