| UniProt ID | F122A_HUMAN | |
|---|---|---|
| UniProt AC | Q96E09 | |
| Protein Name | Protein FAM122A | |
| Gene Name | FAM122A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 287 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of F122A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F122A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F122A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F122A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| KLH15_HUMAN | KLHL15 | physical | 26186194 | |
| 2AAA_HUMAN | PPP2R1A | physical | 26186194 | |
| PP2BA_HUMAN | PPP3CA | physical | 26186194 | |
| F122B_HUMAN | FAM122B | physical | 26186194 | |
| 2ABD_HUMAN | PPP2R2D | physical | 26186194 | |
| 2ABA_HUMAN | PPP2R2A | physical | 26186194 | |
| CANB1_HUMAN | PPP3R1 | physical | 26186194 | |
| RCAN1_HUMAN | RCAN1 | physical | 26186194 | |
| PP2BA_HUMAN | PPP3CA | physical | 28514442 | |
| 2ABD_HUMAN | PPP2R2D | physical | 28514442 | |
| RCAN1_HUMAN | RCAN1 | physical | 28514442 | |
| F122B_HUMAN | FAM122B | physical | 28514442 | |
| CANB1_HUMAN | PPP3R1 | physical | 28514442 | |
| 2AAA_HUMAN | PPP2R1A | physical | 28514442 | |
| KLH15_HUMAN | KLHL15 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
