UniProt ID | F122A_HUMAN | |
---|---|---|
UniProt AC | Q96E09 | |
Protein Name | Protein FAM122A | |
Gene Name | FAM122A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 287 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of F122A_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F122A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F122A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F122A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
KLH15_HUMAN | KLHL15 | physical | 26186194 | |
2AAA_HUMAN | PPP2R1A | physical | 26186194 | |
PP2BA_HUMAN | PPP3CA | physical | 26186194 | |
F122B_HUMAN | FAM122B | physical | 26186194 | |
2ABD_HUMAN | PPP2R2D | physical | 26186194 | |
2ABA_HUMAN | PPP2R2A | physical | 26186194 | |
CANB1_HUMAN | PPP3R1 | physical | 26186194 | |
RCAN1_HUMAN | RCAN1 | physical | 26186194 | |
PP2BA_HUMAN | PPP3CA | physical | 28514442 | |
2ABD_HUMAN | PPP2R2D | physical | 28514442 | |
RCAN1_HUMAN | RCAN1 | physical | 28514442 | |
F122B_HUMAN | FAM122B | physical | 28514442 | |
CANB1_HUMAN | PPP3R1 | physical | 28514442 | |
2AAA_HUMAN | PPP2R1A | physical | 28514442 | |
KLH15_HUMAN | KLHL15 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...