| UniProt ID | CANB1_HUMAN | |
|---|---|---|
| UniProt AC | P63098 | |
| Protein Name | Calcineurin subunit B type 1 | |
| Gene Name | PPP3R1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 170 | |
| Subcellular Localization |
Cytoplasm, cytosol . Cell membrane . Cell membrane, sarcolemma . Cell membrane Lipid-anchor . Translocates from the cytosol to the sarcolemma in a CIB1-dependent manner during cardiomyocyte hypertrophy. |
|
| Protein Description | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.. | |
| Protein Sequence | MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGNEASYPL ------CCCCCCCCH | 40.46 | 25255805 | |
| 7 | Phosphorylation | -MGNEASYPLEMCSH -CCCCCCCCHHHHCC | 20.91 | 24719451 | |
| 13 | Phosphorylation | SYPLEMCSHFDADEI CCCHHHHCCCCHHHH | 26.36 | 24719451 | |
| 29 | Ubiquitination | RLGKRFKKLDLDNSG HHHHHHHHCCCCCCC | 44.51 | 21906983 | |
| 35 | Phosphorylation | KKLDLDNSGSLSVEE HHCCCCCCCCCCHHH | 29.44 | 25159151 | |
| 37 | Phosphorylation | LDLDNSGSLSVEEFM CCCCCCCCCCHHHHH | 19.79 | 25159151 | |
| 39 | Phosphorylation | LDNSGSLSVEEFMSL CCCCCCCCHHHHHCC | 29.22 | 18669648 | |
| 45 | Phosphorylation | LSVEEFMSLPELQQN CCHHHHHCCHHHHCC | 46.20 | 27251275 | |
| 64 | Phosphorylation | RVIDIFDTDGNGEVD HHHEEECCCCCCEEC | 34.75 | 20068231 | |
| 85 | Ubiquitination | GVSQFSVKGDKEQKL CCCEEEECCCHHHHE | 61.26 | 32015554 | |
| 103 | Ubiquitination | FRIYDMDKDGYISNG EEEEECCCCCCCCHH | 46.55 | - | |
| 106 | Phosphorylation | YDMDKDGYISNGELF EECCCCCCCCHHHHH | 16.00 | 21082442 | |
| 108 | Phosphorylation | MDKDGYISNGELFQV CCCCCCCCHHHHHHH | 30.23 | - | |
| 125 | Ubiquitination | MMVGNNLKDTQLQQI HHHCCCCCHHHHHHH | 61.93 | 21906983 | |
| 135 | Ubiquitination | QLQQIVDKTIINADK HHHHHHCCEEECCCC | 30.63 | 29967540 | |
| 142 | Ubiquitination | KTIINADKDGDGRIS CEEECCCCCCCCCCC | 62.29 | 29967540 | |
| 164 | Ubiquitination | VGGLDIHKKMVVDV- HCCCCCCCCCEECC- | 42.79 | 32015554 | |
| 165 | Ubiquitination | GGLDIHKKMVVDV-- CCCCCCCCCEECC-- | 23.82 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CANB1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CANB1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CANB1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CABP2_HUMAN | CABP2 | physical | 11108966 | |
| CABP5_HUMAN | CABP5 | physical | 11108966 | |
| CABP1_HUMAN | CABP1 | physical | 11108966 | |
| PSA7_HUMAN | PSMA7 | physical | 21256111 | |
| PDE4D_HUMAN | PDE4D | physical | 20647544 | |
| PP2BA_HUMAN | PPP3CA | physical | 22939629 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
