CABP5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CABP5_HUMAN
• UniProt AC: Q9NP86
• Protein Name: Calcium-binding protein 5
• Gene Name: CABP5
• Organism: Homo sapiens (Human).
• Sequence Length: 173
• Subcellular Localization: Cytoplasm .
• Protein Description: Inhibits calcium-dependent inactivation of L-type calcium channel and shifts voltage dependence of activation to more depolarized membrane potentials. Involved in the transmission of light signals (By similarity)..
• Protein Sequence: MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	NLMRTMGYMPTEMEL HHHHHCCCCCCHHHH	6.79	24114839
65	Phosphorylation	RTMGYMPTEMELIEL HHCCCCCCHHHHHHH	31.28	24114839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CABP5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CABP5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CABP5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CEP76_HUMAN	CEP76	physical	25416956
ZKSC4_HUMAN	ZKSCAN4	physical	25416956
INCA1_HUMAN	INCA1	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.