UniProt ID | INCA1_HUMAN | |
---|---|---|
UniProt AC | Q0VD86 | |
Protein Name | Protein INCA1 | |
Gene Name | INCA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLRATGCSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | CSRVVSRSPPPRLPS CCCCCCCCCCCCCCC | 33.96 | 26699800 | |
92 | Acetylation | PEMLWRRKKRRPCLE HHHHHCCCCCCCCHH | 41.90 | 12433563 | |
93 | Acetylation | EMLWRRKKRRPCLEG HHHHCCCCCCCCHHH | 52.40 | 12433573 | |
182 | Phosphorylation | QEEDRFLTPGRAQLL CHHHCCCCCCCCCEE | 22.45 | 22817900 | |
191 | Phosphorylation | GRAQLLWSPWSPLDQ CCCCEECCCCCCCCH | 19.23 | 22817900 | |
194 | Phosphorylation | QLLWSPWSPLDQEEA CEECCCCCCCCHHHH | 20.97 | 15159402 | |
209 | Phosphorylation | CASRQLHSLASFSTV HHHHHHHHHHCCCCC | 33.93 | 28270605 | |
212 | Phosphorylation | RQLHSLASFSTVTAR HHHHHHHCCCCCCCC | 25.64 | 28270605 | |
214 | Phosphorylation | LHSLASFSTVTARRN HHHHHCCCCCCCCCC | 21.33 | 28270605 | |
215 | Phosphorylation | HSLASFSTVTARRNP HHHHCCCCCCCCCCC | 21.62 | 28270605 | |
217 | Phosphorylation | LASFSTVTARRNPLH HHCCCCCCCCCCCCC | 17.97 | 28270605 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of INCA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of INCA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCNA1_HUMAN | CCNA1 | physical | 15159402 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Identification of interaction partners and substrates of the cyclinA1-CDK2 complex."; Diederichs S., Baeumer N., Ji P., Metzelder S.K., Idos G.E.,Cauvet T., Wang W., Moeller M., Pierschalski S., Gromoll J.,Schrader M.G., Koeffler H.P., Berdel W.E., Serve H., Mueller-Tidow C.; J. Biol. Chem. 279:33727-33741(2004). Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH CCNA1,IDENTIFICATION IN A COMPLEX WITH CCNA1 AND CDK2, PHOSPHORYLATION ATSER-23; THR-182; SER-191 AND SER-194, MUTAGENESIS OF SER-23; THR-182;SER-191 AND SER-194, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY. |