UniProt ID | CABP2_HUMAN | |
---|---|---|
UniProt AC | Q9NPB3 | |
Protein Name | Calcium-binding protein 2 | |
Gene Name | CABP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 220 | |
Subcellular Localization |
Cytoplasm, perinuclear region . Cell membrane Lipid-anchor Cytoplasmic side . Golgi apparatus . |
|
Protein Description | Required for sound encoding at inner hair cells (IHCs) synapses, likely via inhibition of the inactivation of voltage-gated calcium channel of type 1.3 (Cav1.3) in the IHCs. [PubMed: 28183797 Required for the normal transfer of light signals through the retina (By similarity] | |
Protein Sequence | MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CABP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CABP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CABP2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
614899 | Deafness, autosomal recessive, 93 (DFNB93) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Myristoylation | |
Reference | PubMed |
"Five members of a novel Ca(2+)-binding protein (CABP) subfamily withsimilarity to calmodulin."; Haeseleer F., Sokal I., Verlinde C.L.M.J., Erdjument-Bromage H.,Tempst P., Pronin A.N., Benovic J.L., Fariss R.N., Palczewski K.; J. Biol. Chem. 275:1247-1260(2000). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS L-CABP2 ANDS-CABP2), VARIANT GLN-94, AND MYRISTOYLATION AT GLY-2. |