UniProt ID | FXL16_HUMAN | |
---|---|---|
UniProt AC | Q8N461 | |
Protein Name | F-box/LRR-repeat protein 16 | |
Gene Name | FBXL16 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 479 | |
Subcellular Localization | ||
Protein Description | Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.. | |
Protein Sequence | MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSLAAPLSRAALAGGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLALGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSPGIDGD ------CCCCCCCCC | 45.28 | 25627689 | |
3 | Phosphorylation | -----MSSPGIDGDP -----CCCCCCCCCC | 26.33 | 25159151 | |
92 | Methylation | APGHPAERPPLATDE CCCCCCCCCCCCCCH | 40.00 | - | |
155 | Ubiquitination | NVLPGGEKEFVNLQG HCCCCCCEEEECCHH | 60.78 | 30230243 | |
196 | Acetylation | ALSKKGVKAMSLKRS HHCCCCCCEEECCCC | 47.22 | 18604523 | |
248 | Phosphorylation | SARITSLSVSDCINV HHHHHCCCHHHHCCH | 21.24 | - | |
250 | Phosphorylation | RITSLSVSDCINVAD HHHCCCHHHHCCHHH | 24.32 | - | |
350 | Phosphorylation | ENLRKLRSLDLSWCP HHHHHHHCCCCCCCC | 36.35 | 22817900 | |
388 | Phosphorylation | RCVRITDTGLSYLST HCEECCCCCHHHHHH | 31.22 | 26503514 | |
391 | Phosphorylation | RITDTGLSYLSTMSS ECCCCCHHHHHHHHH | 25.93 | 26503514 | |
392 | Phosphorylation | ITDTGLSYLSTMSSL CCCCCHHHHHHHHHH | 15.09 | 26503514 | |
394 | Phosphorylation | DTGLSYLSTMSSLRS CCCHHHHHHHHHHHH | 17.52 | 26503514 | |
423 | Phosphorylation | KHLLALGSLRLLSLA HHHHHHHHHHHHHHC | 15.92 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FXL16_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FXL16_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FXL16_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HPCL4_HUMAN | HPCAL4 | physical | 24035498 | |
DAAM1_HUMAN | DAAM1 | physical | 28514442 | |
UBB_HUMAN | UBB | physical | 28514442 | |
FXL18_HUMAN | FBXL18 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...