UniProt ID | HPCL4_HUMAN | |
---|---|---|
UniProt AC | Q9UM19 | |
Protein Name | Hippocalcin-like protein 4 | |
Gene Name | HPCAL4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 191 | |
Subcellular Localization | ||
Protein Description | May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.. | |
Protein Sequence | MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGKTNSKLA ------CCCCCCCCC | 45.56 | - | |
40 | Phosphorylation | GFLKDCPSGILNLEE HHHHHCCCCCCCHHH | 44.81 | - | |
52 | Phosphorylation | LEEFQQLYIKFFPYG HHHHHHHHHHHCCCC | 9.57 | - | |
74 | Acetylation | HAFRTFDKNGDGTID HHHHHCCCCCCCEEE | 59.65 | 14509389 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPCL4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPCL4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPCL4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DTX2_HUMAN | DTX2 | physical | 16189514 | |
TTC12_HUMAN | TTC12 | physical | 25416956 | |
DTX2_HUMAN | DTX2 | physical | 25416956 | |
F131C_HUMAN | FAM131C | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...