UniProt ID | QCR9_HUMAN | |
---|---|---|
UniProt AC | Q9UDW1 | |
Protein Name | Cytochrome b-c1 complex subunit 9 | |
Gene Name | UQCR10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 63 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity).. | |
Protein Sequence | MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | DQGADAIYDHINEGK HHCCHHHHHHCHHCC | 11.82 | 29978859 | |
51 | Ubiquitination | YDHINEGKLWKHIKH HHHCHHCCHHHHHHH | 45.02 | 21890473 | |
51 | 2-Hydroxyisobutyrylation | YDHINEGKLWKHIKH HHHCHHCCHHHHHHH | 45.02 | - | |
51 | Acetylation | YDHINEGKLWKHIKH HHHCHHCCHHHHHHH | 45.02 | 27452117 | |
54 | Acetylation | INEGKLWKHIKHKYE CHHCCHHHHHHHHHC | 45.98 | 27178108 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of QCR9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of QCR9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of QCR9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RB11A_HUMAN | RAB11A | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...