| UniProt ID | MAIP1_HUMAN | |
|---|---|---|
| UniProt AC | Q8WWC4 | |
| Protein Name | m-AAA protease-interacting protein 1, mitochondrial {ECO:0000303|PubMed:27642048} | |
| Gene Name | MAIP1 {ECO:0000303|PubMed:27642048, ECO:0000312|HGNC:HGNC:26198} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 291 | |
| Subcellular Localization | Mitochondrion matrix . | |
| Protein Description | Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. [PubMed: 27642048 Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB)] | |
| Protein Sequence | MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 64 | Phosphorylation | SARALAASALPAQGS HHHHHHHHCCCCCCC | 20860994 | ||
| 95 | Phosphorylation | FPACPQRSYSTEEKP CCCCCCCCCCCCCCC | - | ||
| 97 | Phosphorylation | ACPQRSYSTEEKPQQ CCCCCCCCCCCCCCC | - | ||
| 98 | Phosphorylation | CPQRSYSTEEKPQQH CCCCCCCCCCCCCCC | - | ||
| 149 | Ubiquitination | TEFSEGAKQAFAHVS CCCCHHHHHHHHHHH | - | ||
| 156 | Phosphorylation | KQAFAHVSKLLSQCK HHHHHHHHHHHHHCC | 24732914 | ||
| 163 | Ubiquitination | SKLLSQCKFDLLEEL HHHHHHCCCHHHHHH | - | ||
| 163 | 2-Hydroxyisobutyrylation | SKLLSQCKFDLLEEL HHHHHHCCCHHHHHH | - | ||
| 173 | Ubiquitination | LLEELVAKEVLHALK HHHHHHHHHHHHHHH | - | ||
| 180 | Acetylation | KEVLHALKEKVTSLP HHHHHHHHHHHHCCC | 23236377 | ||
| 180 | Succinylation | KEVLHALKEKVTSLP HHHHHHHHHHHHCCC | 23954790 | ||
| 182 | Ubiquitination | VLHALKEKVTSLPDN HHHHHHHHHHCCCCC | - | ||
| 182 | 2-Hydroxyisobutyrylation | VLHALKEKVTSLPDN HHHHHHHHHHCCCCC | - | ||
| 249 | Ubiquitination | GASVFQVKLGNQNVE CCEEEEEEECCCCHH | - | ||
| 257 | Phosphorylation | LGNQNVETKQLLSAS ECCCCHHHHHHHHHH | 20068231 | ||
| 262 | Phosphorylation | VETKQLLSASYEFQR HHHHHHHHHHHHHHH | - | ||
| 276 | Ubiquitination | REFTQGVKPDWTIAR HHHCCCCCCCCEEEE | 21890473 | ||
| 280 | Phosphorylation | QGVKPDWTIARIEHS CCCCCCCEEEEECCH | 24719451 | ||
| 287 | Phosphorylation | TIARIEHSKLLE--- EEEEECCHHHCC--- | 24719451 | ||
| 288 | Ubiquitination | IARIEHSKLLE---- EEEECCHHHCC---- | - | ||
| 288 | Acetylation | IARIEHSKLLE---- EEEECCHHHCC---- | 25953088 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MAIP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAIP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAIP1_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
