UniProt ID | ARL5B_HUMAN | |
---|---|---|
UniProt AC | Q96KC2 | |
Protein Name | ADP-ribosylation factor-like protein 5B | |
Gene Name | ARL5B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 179 | |
Subcellular Localization | ||
Protein Description | Binds and exchanges GTP and GDP.. | |
Protein Sequence | MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGLIFAKLW ------CCHHHHHHH | 27.72 | - | |
103 | Ubiquitination | RERLAITKEELYRML HHHHCCCHHHHHHHH | 42.98 | 21890473 | |
117 | Ubiquitination | LAHEDLRKAAVLIFA HCCHHHHHHHHHHCC | 48.25 | - | |
126 | Ubiquitination | AVLIFANKQDMKGCM HHHHCCCCCCCCCCC | 44.22 | - | |
130 | Ubiquitination | FANKQDMKGCMTAAE CCCCCCCCCCCCHHH | 58.19 | - | |
145 | Phosphorylation | ISKYLTLSSIKDHPW HHHHHCHHHCCCCCC | 25.45 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL5B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL5B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL5B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARL5B_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...