UniProt ID | NDUA4_HUMAN | |
---|---|---|
UniProt AC | O00483 | |
Protein Name | Cytochrome c oxidase subunit NDUFA4 | |
Gene Name | NDUFA4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 81 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
Protein Description | Cytochrome c oxidase (COX, complex IV) is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. Required for complex IV maintenance.. | |
Protein Sequence | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Acetylation | RQIIGQAKKHPSLIP HHHHHHHHHCCHHEE | 43.67 | - | |
10 | "N6,N6-dimethyllysine" | RQIIGQAKKHPSLIP HHHHHHHHHCCHHEE | 43.67 | - | |
10 | Succinylation | RQIIGQAKKHPSLIP HHHHHHHHHCCHHEE | 43.67 | 23954790 | |
10 | Methylation | RQIIGQAKKHPSLIP HHHHHHHHHCCHHEE | 43.67 | - | |
10 | 2-Hydroxyisobutyrylation | RQIIGQAKKHPSLIP HHHHHHHHHCCHHEE | 43.67 | - | |
44 | Glutathionylation | ALFNPDVCWDRNNPE HHHCCCCCCCCCCCC | 4.00 | 22555962 | |
47 | Methylation | NPDVCWDRNNPEPWN CCCCCCCCCCCCCHH | 21.96 | 115484685 | |
55 | Methylation | NNPEPWNKLGPNDQY CCCCCHHHCCCCCCE | 51.45 | 88411 | |
55 | Acetylation | NNPEPWNKLGPNDQY CCCCCHHHCCCCCCE | 51.45 | 25825284 | |
55 | Ubiquitination | NNPEPWNKLGPNDQY CCCCCHHHCCCCCCE | 51.45 | 21906983 | |
62 | Phosphorylation | KLGPNDQYKFYSVNV HCCCCCCEEEEEEEC | 13.11 | - | |
62 | Nitration | KLGPNDQYKFYSVNV HCCCCCCEEEEEEEC | 13.11 | - | |
63 | Methylation | LGPNDQYKFYSVNVD CCCCCCEEEEEEECC | 31.99 | 30590705 | |
63 | Ubiquitination | LGPNDQYKFYSVNVD CCCCCCEEEEEEECC | 31.99 | 21906983 | |
63 | Acetylation | LGPNDQYKFYSVNVD CCCCCCEEEEEEECC | 31.99 | 30590705 | |
65 | Phosphorylation | PNDQYKFYSVNVDYS CCCCEEEEEEECCHH | 13.93 | 28152594 | |
66 | Phosphorylation | NDQYKFYSVNVDYSK CCCEEEEEEECCHHH | 15.45 | 30108239 | |
71 | Phosphorylation | FYSVNVDYSKLKKER EEEEECCHHHHHHHC | 11.92 | 28152594 | |
72 | Phosphorylation | YSVNVDYSKLKKERP EEEECCHHHHHHHCC | 27.35 | 28152594 | |
73 | Acetylation | SVNVDYSKLKKERPD EEECCHHHHHHHCCC | 59.08 | 25825284 | |
73 | Ubiquitination | SVNVDYSKLKKERPD EEECCHHHHHHHCCC | 59.08 | 21906983 | |
73 | 2-Hydroxyisobutyrylation | SVNVDYSKLKKERPD EEECCHHHHHHHCCC | 59.08 | - | |
75 | Ubiquitination | NVDYSKLKKERPDF- ECCHHHHHHHCCCC- | 57.22 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUA4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUA4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUA4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
256000 | Leigh syndrome (LS) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...