TM205_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM205_HUMAN
• UniProt AC: Q6UW68
• Protein Name: Transmembrane protein 205
• Gene Name: TMEM205
• Organism: Homo sapiens (Human).
• Sequence Length: 189
• Subcellular Localization: Membrane ; Multi-pass membrane protein . Located on cell surface microvilli. In cancer cells, transition in subcellular location from cell surface to intracellular regions correlates the progression of cisplatin resistance.
• Protein Description: In cancer cells, plays a role in resistance to the chemotherapeutic agent cisplatin..
• Protein Sequence: MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHISMGCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
122	2-Hydroxyisobutyrylation	WALQTVEKERGLGGE HHHHHHHHHCCCCCC	48.66	-
122	Ubiquitination	WALQTVEKERGLGGE HHHHHHHHHCCCCCC	48.66	21906983
133	Phosphorylation	LGGEVPGSHQGPDPY CCCCCCCCCCCCCHH	13.43	27174698
140	Phosphorylation	SHQGPDPYRQLREKD CCCCCCHHHHHHHHC	20.55	27174698
149	2-Hydroxyisobutyrylation	QLREKDPKYSALRQN HHHHHCCCHHHHHHH	63.07	-
149	Acetylation	QLREKDPKYSALRQN HHHHHCCCHHHHHHH	63.07	19608861
149	Ubiquitination	QLREKDPKYSALRQN HHHHHCCCHHHHHHH	63.07	19608861

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM205_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM205_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM205_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RET4_HUMAN	RBP4	physical	28514442
TPM2_HUMAN	TPM2	physical	28514442
COR1A_HUMAN	CORO1A	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-149, AND MASS SPECTROMETRY.
PubMed: 19608861