ROMO1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ROMO1_HUMAN
• UniProt AC: P60602
• Protein Name: Reactive oxygen species modulator 1
• Gene Name: ROMO1
• Organism: Homo sapiens (Human).
• Sequence Length: 79
• Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein .
• Protein Description: Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.; Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage..
• Protein Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ROMO1_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ROMO1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ROMO1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ROMO1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ERAP1_HUMAN	ERAP1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.