COX8A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COX8A_HUMAN
• UniProt AC: P10176
• Protein Name: Cytochrome c oxidase subunit 8A, mitochondrial
• Gene Name: COX8A
• Organism: Homo sapiens (Human).
• Sequence Length: 69
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport..
• Protein Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSVLTPLLL ------CCCHHHHHH	26.32	24043423
5	Phosphorylation	---MSVLTPLLLRGL ---CCCHHHHHHHCC	15.10	24043423
13	Phosphorylation	PLLLRGLTGSARRLP HHHHHCCCCCCCCCC	31.73	24043423
15	Phosphorylation	LLRGLTGSARRLPVP HHHCCCCCCCCCCCC	17.23	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COX8A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COX8A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COX8A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NPM_HUMAN	NPM1	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.