UniProt ID | COX8A_HUMAN | |
---|---|---|
UniProt AC | P10176 | |
Protein Name | Cytochrome c oxidase subunit 8A, mitochondrial | |
Gene Name | COX8A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 69 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
Protein Sequence | MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSVLTPLLL ------CCCHHHHHH | 26.32 | 24043423 | |
5 | Phosphorylation | ---MSVLTPLLLRGL ---CCCHHHHHHHCC | 15.10 | 24043423 | |
13 | Phosphorylation | PLLLRGLTGSARRLP HHHHHCCCCCCCCCC | 31.73 | 24043423 | |
15 | Phosphorylation | LLRGLTGSARRLPVP HHHCCCCCCCCCCCC | 17.23 | 24043423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX8A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX8A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX8A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...