COX20_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COX20_HUMAN
• UniProt AC: Q5RI15
• Protein Name: Cytochrome c oxidase assembly protein COX20, mitochondrial
• Gene Name: COX20
• Organism: Homo sapiens (Human).
• Sequence Length: 118
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. [PubMed: 23125284 Acts as a chaperone in the early steps of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation, stabilizing the newly synthesized protein and presenting it to metallochaperones SCO1/2 which in turn facilitates the incorporation of the mature MT-CO2/COX2 into the assembling CIV holoenzyme]
• Protein Sequence: MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAPPEPGE ------CCCCCCCCC	28.77	22223895
27	Phosphorylation	GFLDVENTPCARHSI CEECCCCCCCHHHHH	13.26	21815630
29	S-palmitoylation	LDVENTPCARHSILY ECCCCCCCHHHHHHH	4.97	29575903
98	Ubiquitination	AREEIKKKILYEGTH HHHHHHHHHCCCCCC	32.70	2189047
98 (in isoform 1)	Ubiquitination	-	32.70	21890473
101	Phosphorylation	EIKKKILYEGTHLDP HHHHHHCCCCCCCCH	18.78	28152594
104	Phosphorylation	KKILYEGTHLDPERK HHHCCCCCCCCHHHC	13.81	28152594
110 (in isoform 2)	Ubiquitination	-	51.42	21890473
113 (in isoform 2)	Phosphorylation	-	55.89	27642862

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COX20_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COX20_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COX20_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COX2_HUMAN	COX2	physical	23125284
COMD4_HUMAN	COMMD4	physical	26186194
UQCC1_HUMAN	UQCC1	physical	26186194
UQCC2_HUMAN	UQCC2	physical	26186194
GLPK_HUMAN	GK	physical	26186194
UQCC1_HUMAN	UQCC1	physical	28514442
UQCC2_HUMAN	UQCC2	physical	28514442
CSMT1_HUMAN	C16orf91	physical	28514442
ECM1_HUMAN	ECM1	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.