CSMT1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSMT1_HUMAN
• UniProt AC: Q4G0I0
• Protein Name: Protein CCSMST1
• Gene Name: CCSMST1
• Organism: Homo sapiens (Human).
• Sequence Length: 132
• Subcellular Localization: Membrane ; Single-pass type I membrane protein .
• Protein Sequence: MNRVLCAPAAGAVRALRLIGWASRSLHPLPGSRDRAHPAAEEEDDPDRPIEFSSSKANPHRWSVGHTMGKGHQRPWWKVLPLSCFLVALIIWCYLREESEADQWLRQVWGEVPEPSDRSEEPETPAAYRART

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	LIGWASRSLHPLPGS HHHHHHCCCCCCCCC	28.65	23898821
53	Phosphorylation	PDRPIEFSSSKANPH CCCCCCCCCCCCCCC	22.40	26434776
54	Phosphorylation	DRPIEFSSSKANPHR CCCCCCCCCCCCCCC	40.97	26434776
55	Phosphorylation	RPIEFSSSKANPHRW CCCCCCCCCCCCCCC	34.29	26434776
56	Malonylation	PIEFSSSKANPHRWS CCCCCCCCCCCCCCC	54.88	32601280
63	Phosphorylation	KANPHRWSVGHTMGK CCCCCCCCCCCCCCC	20.41	23927012

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSMT1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSMT1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSMT1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CSMT1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.